Align gamma-glutamyl-gamma-aminobutyrate hydrolase (EC: 3.5.1.94) (characterized)
to candidate WP_047212584.1 PATSB16_RS03060 hypothetical protein
Query= reanno::SB2B:6936606 (267 letters) >NCBI__GCF_001931675.1:WP_047212584.1 Length = 380 Score = 113 bits (282), Expect = 7e-30 Identities = 77/217 (35%), Positives = 118/217 (54%), Gaps = 19/217 (8%) Query: 29 AYQVMTHKYMQPVVDISDCIPLLIPTCFGVADIEQYLDMADGVYLSGAASNIDPSLYGQE 88 A+ VM+ + ++ D LL P+ + D ++LD G+ L G A ++ P Y + Sbjct: 157 AHWVMSRDVLVFMIPTVDTQGLLHPSHIRLRDYAKHLD---GLVLQGGA-DVSPQSYSEV 212 Query: 89 NLTPEKKQDLARDLVDIALIKGAVKRGLPILGICRGMQEMNIAFGGDLYQKVHDEDHLND 148 E + D RD+ ++ L+ + G P+LG+CRG Q +N+AFGG LYQ + Sbjct: 213 ATRHEWQGDRMRDMYELELLHEFIDAGKPVLGVCRGCQLINVAFGGTLYQDI-------- 264 Query: 149 HREDPDTPPDV--QYGAS-HSISMVKGSWLHKLLG--DTIEVNSLHGQGIKTLGKGLEAL 203 E PD P V QY A+ H++S +GS L +L T VNS+H Q ++TLG+ L Sbjct: 265 QTELPDAIPHVNEQYDANRHTLSFPEGSSLKAMLAAQGTPIVNSIHHQSVRTLGRDLSVE 324 Query: 204 AL-AEDGLVEALHAPYLPQFTLGVQWHPEWKALENPD 239 A+ AEDG++EA+ P F +G+QWHPE+ P+ Sbjct: 325 AISAEDGVIEAIRHRKSP-FVVGLQWHPEFHRAGGPE 360 Lambda K H 0.318 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 239 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 380 Length adjustment: 27 Effective length of query: 240 Effective length of database: 353 Effective search space: 84720 Effective search space used: 84720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory