Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate WP_047214724.1 PATSB16_RS13940 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase
Query= curated2:Q9X448 (316 letters) >NCBI__GCF_001931675.1:WP_047214724.1 Length = 307 Score = 305 bits (781), Expect = 9e-88 Identities = 165/294 (56%), Positives = 208/294 (70%), Gaps = 2/294 (0%) Query: 20 RAEAPAVTI-VAHPCDETSLGGAIEAAEMGLITPILVAPEAKIRNVAAEHRLDLGRREIV 78 +A ++TI V +PC+E SL AI A+ GL +LV P ++ VAA +DL +V Sbjct: 14 QAAGSSITIAVVYPCEEVSLRAAIGASTRGLGKLLLVGPRERMTQVAAAGGIDLSGATLV 73 Query: 79 DVPHSHAAAAK-AVALIREGRGELLMKGSLHTDELMHEVAASATGLRTQRRISHVFVMDV 137 D P AAA+ A AL+ +G+ + +MKGSLHTDELM + GLRT RRISHVF+ D+ Sbjct: 74 DTPDDPVAAAREAAALVGQGQAQAIMKGSLHTDELMGVLVGREAGLRTSRRISHVFLFDM 133 Query: 138 PGHTDTLFITDAAINIFPDLEAKRDIVQNAIDLWVAIGLGEPRVAILSAVETVTAKIPST 197 L +TD +NI PDL KRDIVQNAIDL +G+ +P V ILSA E+V IP T Sbjct: 134 ADMPKPLMLTDCVVNIAPDLMVKRDIVQNAIDLAHVVGIAKPLVGILSATESVNPAIPGT 193 Query: 198 IEAAALCKMAERGQITGGVLEGPLAFDNAIDQEAARIKGINSPVAGHAQILVVPDLEAGN 257 ++AAALCKMA+RGQITGGVL+GPLAFDNAI E+ARIK I+SPVAGH IL+VP+LE GN Sbjct: 194 LDAAALCKMADRGQITGGVLDGPLAFDNAISLESARIKKIHSPVAGHPDILLVPNLETGN 253 Query: 258 MLAKNLTFLTHADAAGLVLGARVPIVLTSRADSVRTRLASCAVAALYAARRRAA 311 L K+L +L HA+ AGLVLG RVP++LTSRADS +RLAS A+ L+AAR+ AA Sbjct: 254 TLYKSLVYLGHAECAGLVLGTRVPVILTSRADSPFSRLASVALGVLFAARKPAA 307 Lambda K H 0.320 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 307 Length adjustment: 27 Effective length of query: 289 Effective length of database: 280 Effective search space: 80920 Effective search space used: 80920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory