Align Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 (characterized)
to candidate WP_047216787.1 PATSB16_RS19810 NADP-dependent malic enzyme
Query= SwissProt::P77844 (329 letters) >NCBI__GCF_001931675.1:WP_047216787.1 Length = 758 Score = 170 bits (431), Expect = 9e-47 Identities = 111/318 (34%), Positives = 172/318 (54%), Gaps = 13/318 (4%) Query: 14 ARAEHSHIVLPEGDDDRILMAAHQLLDQDICDITILGDPVKIKERATELGLHLNTAY--- 70 A+A + IV EG+D+R+L AA +L + I I+G P ++ R ++G + Sbjct: 437 AKARPARIVFAEGEDERVLRAAQFVLTEGIAKPIIIGRPSVVEMRLQKIGARIKPGVDFE 496 Query: 71 LVNPLTDPRLEEFAEQFAELRKSKSVTIDEAREIM-KDISYFGTMMVHNGDADGMVSGAA 129 +V+P D R ++ +++ L VT D A+ M KD + G ++V GDADGM+ G Sbjct: 497 IVDPENDARYQQCWQEYHNLGARHGVTPDVAKAAMRKDNTLIGAILVRLGDADGMICGMI 556 Query: 130 NTTAHTIKPSFQIIKTVPEASVVSSIFLMVLRGRLWAFGDCAVNPNPTAEQLGEIAVVSA 189 +T + Q++ P+A +++ L++L GR D VN P +EQL ++ V++A Sbjct: 557 DTFHRHLGVIDQVLGKAPDAQHYAAMNLLMLSGRNLFISDTYVNELPNSEQLADMTVLAA 616 Query: 190 KTAAQFGIDPRVAILSYSTGNSGGGSDVDRAIDALAEARRL----NPELCVDGPLQFDAA 245 + +FGI P+VA+LS NS GS + +A+AR L P L VDG + DAA Sbjct: 617 REIERFGIVPKVALLS----NSNFGSVASASAQRMAKARELLAERAPALEVDGEMHGDAA 672 Query: 246 VDPGVARKKMPDSDVAGQANVFIFPDLEAGNIGYKTAQRT-GHALAVGPILQGLNKPVND 304 + V R P S ++G+AN+ + P++EA NI Y + T G + VGP L G KPV+ Sbjct: 673 LSETVRRAAFPASRLSGEANLLVMPNVEAANITYNLLKMTSGEGVTVGPFLLGCAKPVHI 732 Query: 305 LSRGATVPDIVNTVAITA 322 L+ ATV IVN + A Sbjct: 733 LTPAATVRRIVNMTTVAA 750 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 758 Length adjustment: 34 Effective length of query: 295 Effective length of database: 724 Effective search space: 213580 Effective search space used: 213580 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory