Align L-lactaldehyde reductase (EC 1.1.1.77) (characterized)
to candidate WP_047214189.1 PATSB16_RS11085 iron-containing alcohol dehydrogenase
Query= metacyc::STM4044-MONOMER (382 letters) >NCBI__GCF_001931675.1:WP_047214189.1 Length = 412 Score = 140 bits (354), Expect = 5e-38 Identities = 109/363 (30%), Positives = 169/363 (46%), Gaps = 23/363 (6%) Query: 8 PKISLHGAGAIADMVNLVANKQWGKALIVTDGQLVK-LGLLDSLFSALDEHQMSYHLFDE 66 P L AGA A + L+ + + ++VTD + + A + + ++ Sbjct: 12 PSRLLIEAGARARLPTLLHHLGYRCGVLVTDEFFARQTSWVTEYVEAAAAYGIDTLVYAG 71 Query: 67 VFPNPT----EELVQKGFAAYQSAECDYIIAFGGGSPIDTAKAVKILTANPGPSTAYSGV 122 P+PT +E ++ A + D++IA GGGS ID AKA+ + + P + Sbjct: 72 GLPDPTTALCDEATRRLRAQLDNRVLDHVIALGGGSNIDLAKALCLTLVSGQPVREFVDG 131 Query: 123 GKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSARKVKEVIIDPNIIPDIAVDDASVMLEI 182 +PLVA+ TTAGT +E T A+++D K ++D + P IA+ D + Sbjct: 132 IPAGLHPLPLVAMPTTAGTGSEATPGAILVDPDNATKVAVMDNRLRPIIALIDPELTYTC 191 Query: 183 PASVTAATGMDALTHAVEAYVSV----------------GAHPLTDANALEAIRLINLWL 226 P VTA G+DALTHAVE+++++ G LT A EAI L +L Sbjct: 192 PPRVTADAGVDALTHAVESFLTLDSSQFDRAGHADPGYSGRSSLTMLFAREAISLCARFL 251 Query: 227 PKAVDDGHNLEAREQMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPI 286 +A DG ++EAR MA+ A +++ SAGL VH +A+ + HG NA++LP Sbjct: 252 ERAYRDGSDIEARHGMAYASIYAALSYGSAGLNAVHGIAYAVAGLTHQSHGSTNAVMLPY 311 Query: 287 VENFNRPNAVARFARIAQAMGVETRGMSDEAASQEAINAIRTLSKRVGIPEGFSKLGVTK 346 V + A IA+ GV + A A IR L R+GIP GV++ Sbjct: 312 VLDELHGVRQRELAEIARLFGVNAPSPVEAAVRLPA--TIRELISRLGIPITLQGFGVSR 369 Query: 347 EDI 349 + Sbjct: 370 SQL 372 Lambda K H 0.317 0.133 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 434 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 412 Length adjustment: 31 Effective length of query: 351 Effective length of database: 381 Effective search space: 133731 Effective search space used: 133731 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory