Align 5-keto-4-deoxy-D-glucarate aldolase; KDGluc aldolase; KDGlucA; 2-dehydro-3-deoxy-D-glucarate aldolase; 2-keto-3-deoxy-D-glucarate aldolase; 5-dehydro-4-deoxy-D-glucarate aldolase; Alpha-keto-beta-deoxy-D-glucarate aldolase; EC 4.1.2.20 (characterized)
to candidate WP_047213791.1 PATSB16_RS08695 4-hydroxy-2-oxoheptanedioate aldolase
Query= SwissProt::P23522 (256 letters) >NCBI__GCF_001931675.1:WP_047213791.1 Length = 269 Score = 238 bits (607), Expect = 1e-67 Identities = 125/252 (49%), Positives = 167/252 (66%), Gaps = 2/252 (0%) Query: 6 FP-NKFKAALAAKQVQIGCWSALSNPISTEVLGLAGFDWLVLDGEHAPNDISTFIPQLMA 64 FP N F+ AL A + QIG W L++ + E+L AGFDWL++DGEHAPN++ + + QL A Sbjct: 3 FPRNTFRQALLAGEQQIGLWLGLASAYTAELLAGAGFDWLLIDGEHAPNNVPSILAQLQA 62 Query: 65 LKGSASAPVVRVPTNEPVIIKRLLDIGFYNFLIPFVETKEEAELAVASTRYPPEGIRGVS 124 + PVVR N+ V IK+LLDIG N L+P V+ +A AVA+TRYPP+GIRGV+ Sbjct: 63 VAPYPVRPVVRAAWNDAVQIKQLLDIGAQNLLVPMVQDANQAAAAVAATRYPPQGIRGVA 122 Query: 125 VSH-RANMFGTVADYFAQSNKNITILVQIESQQGVDNVDAIAATEGVDGIFVGPSDLAAA 183 S RA+ + V DY ++N + +LVQ+E++ + N++AIAA +GVDGIF+GP+DLAA Sbjct: 123 SSIVRASRWNRVPDYIHRANDEMCVLVQVETRAALANIEAIAAVDGVDGIFIGPADLAAD 182 Query: 184 LGHLGNASHPDVQKAIQHIFNRASAHGKPSGILAPVEADARRYLEWGATFVAVGSDLGVF 243 GHLGN HPDVQ+AI R A GK +GIL+ E AR Y+ G+TF AVG D V Sbjct: 183 FGHLGNPGHPDVQRAIDDGLRRIRAAGKAAGILSSDEKQARHYMAQGSTFTAVGVDAAVL 242 Query: 244 RSATQKLADTFK 255 + Q LA FK Sbjct: 243 ARSAQALAAQFK 254 Lambda K H 0.318 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 256 Length of database: 269 Length adjustment: 25 Effective length of query: 231 Effective length of database: 244 Effective search space: 56364 Effective search space used: 56364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory