Align 2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60) (characterized)
to candidate WP_047212662.1 PATSB16_RS03530 NAD(P)-dependent oxidoreductase
Query= BRENDA::Q8ZLV8 (296 letters) >NCBI__GCF_001931675.1:WP_047212662.1 Length = 292 Score = 206 bits (524), Expect = 5e-58 Identities = 113/288 (39%), Positives = 161/288 (55%) Query: 1 MTMKVGFIGLGIMGKPMSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCD 60 MT + FIGLG MG M ++L+ AG++L + R PEA A + AGA+ + A Sbjct: 1 MTYTIAFIGLGAMGGAMVRHLMAAGHTLHLYARRPEAAAPFVEAGAQLFHSPAEAARSAQ 60 Query: 61 VIITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISDALKAKGVEMLDA 120 + T + + V+ V LGE G+I GA+PGT+ ID S+IA A+R I+ L G+EMLDA Sbjct: 61 FVFTNVTRTSDVEAVLLGEQGVIHGAQPGTICIDHSTIAADATRRIAARLAEHGIEMLDA 120 Query: 121 PVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTGDIGAGNVTKLANQVIVA 180 PVSGG +A D +LS+MVGG I + L++ + S+ H G GAG V K NQ++ Sbjct: 121 PVSGGSNRAADASLSIMVGGKAEILARAKPLLEKLGTSITHIGGAGAGQVAKACNQIVQV 180 Query: 181 LNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIK 240 +NI ++EA+ A G +PD V A+ GLAGS +L+ P + R F G LH K Sbjct: 181 VNIEGIAEAMLYAQSNGADPDKVLAALSTGLAGSRMLETMGPKMAHREFAAGIEARLHDK 240 Query: 241 DLANALDTSHGVGAQLPLTAAVMEMMQALRADGHGNDDHSALACYYEK 288 D ++ + G +LP T V + L G G+DD S+L E+ Sbjct: 241 DFEMIVEAARAQGLKLPATELVKRQLTDLVEQGWGHDDTSSLLRVVER 288 Lambda K H 0.316 0.132 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 181 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 296 Length of database: 292 Length adjustment: 26 Effective length of query: 270 Effective length of database: 266 Effective search space: 71820 Effective search space used: 71820 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory