Align (S)-citramalyl-CoA lyase (EC 4.1.3.25) (characterized)
to candidate WP_047213426.1 PATSB16_RS07145 CoA ester lyase
Query= BRENDA::Q9I562 (275 letters) >NCBI__GCF_001931675.1:WP_047213426.1 Length = 271 Score = 182 bits (463), Expect = 5e-51 Identities = 116/267 (43%), Positives = 152/267 (56%), Gaps = 10/267 (3%) Query: 6 VRSALFVPATRPERIPKALASGADRVIVDLEDAVEEGLKVEARANLRRFLVDT--PEARV 63 V S LFVP RPER KAL SGA+R+I+DLEDAV K ARA L +L P+ R+ Sbjct: 3 VHSYLFVPGERPERFSKALDSGAERIILDLEDAVAPAAKGTARAALAEWLQARGGPDMRI 62 Query: 64 LVRINAAEHPGHADDLALCRDHAGVIGLLLPKVESAAQVR--HAAVASGKPVWPIVESAR 121 LVR+N P HADD+AL A V G++LPK E A + A + G+ + +VES Sbjct: 63 LVRVNGVNTPWHADDMALAALPA-VAGIMLPKSEERAALSAVRARLRPGQELHALVESVA 121 Query: 122 GLAALGEIAAAAGVERLSFGSLDLALDLDLNSGSNAAEQILGHARYALLLQTRLAGLAPP 181 GL L EIA G+ R++FGS+D D +G ++ L R L++++R A L P Sbjct: 122 GLVHLREIAGTPGLTRVAFGSVDFCGD----AGIGGDDRELDAIRTQLVIESRYARLPAP 177 Query: 182 LDGVYPAIQNRAGLVEAVRFARDMGFGGLLCIHPSQVEPIHQTLMPSPAELEWARRV-AE 240 +DGV AI + A L V AR GFG LCIHP QV + + +PS E WA RV A Sbjct: 178 VDGVALAIDDAAALEAEVLRARRFGFGAKLCIHPKQVALVQRGFLPSDQERAWAERVLAA 237 Query: 241 AGASGAGVFVVDGEMVDAPVLGRARRL 267 A G +DG++VD PV+ RAR + Sbjct: 238 VAADPHGAIAIDGKLVDKPVVDRARAI 264 Lambda K H 0.320 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 271 Length adjustment: 25 Effective length of query: 250 Effective length of database: 246 Effective search space: 61500 Effective search space used: 61500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory