Align histidine ABC transporter, periplasmic histidine-binding protein HisJ (characterized)
to candidate WP_156884837.1 PATSB16_RS06995 transporter substrate-binding domain-containing protein
Query= CharProtDB::CH_018185 (260 letters) >NCBI__GCF_001931675.1:WP_156884837.1 Length = 257 Score = 108 bits (271), Expect = 8e-29 Identities = 82/254 (32%), Positives = 123/254 (48%), Gaps = 22/254 (8%) Query: 12 LAFS-SATAAFAAIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCTFV 70 LAFS AT A AA I +G D T+ PFE++ G++ GFDID+ + + K Sbjct: 5 LAFSVCATTASAAGKTSIVVGADTTFPPFETE-VNGKVTGFDIDMIEAIAKAEGMTVEIK 63 Query: 71 ENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVAS 130 P + +IPSL+A +DA ++ ++I + R Q + F+D Y + ++V K+S I+ A Sbjct: 64 TMPFNGIIPSLQAGSVDAAVAGITIKKSRMQSVDFSDAYYKSGLSVLVKKDSKIK-DFAD 122 Query: 131 LKGKRVGVLQGTTQETFGNEHWAPKGIE---IVSYQGQDNIYSDLTAGRIDAAFQDEVAA 187 LKG V + T+ + H GI+ I +Q D Y L G DA D Sbjct: 123 LKGHVVATKKATSSVDYMTSH----GIDPNYIKQFQDIDTAYQALETGGADAVVFD---- 174 Query: 188 SEGFLKQPVGKDYKFGGPAVK--DEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTY 245 PV ++K P VK L G G+ + K+D L + +N A+++ G Y Sbjct: 175 ------NPVNVNFKTAHPNVKVVGPLLTGEYYGIAVSKKDPTLVKKINDGLAKIKKSGEY 228 Query: 246 EKLAKKYFDFDVYG 259 +L KYF DV G Sbjct: 229 HQLFVKYFGGDVSG 242 Lambda K H 0.316 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory