Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_047212724.1 PATSB16_RS03890 SDR family oxidoreductase
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >NCBI__GCF_001931675.1:WP_047212724.1 Length = 252 Score = 144 bits (363), Expect = 2e-39 Identities = 83/252 (32%), Positives = 134/252 (53%), Gaps = 2/252 (0%) Query: 18 RLKNKVVLLTGAAQGIGEAIVATFASQQARLVISDIQGEKVEKVAAHWREQGADVVAIKA 77 RL K ++TGA G GE I ATFA + A +V++D+ E ++VA G + Sbjct: 2 RLAGKTAIVTGAGSGFGEGIAATFAREGANVVVNDLNREGGQRVADAINAAGGKAAFVYG 61 Query: 78 DVSRQQDLHAMARLAIELHGRIDVLVNCAGVNVFRDP-LQMTEEDWHRCFAIDLDGAWYG 136 DVS+ D + A+ GR+D++VN AG P L++TE ++ R +A+++ ++ Sbjct: 62 DVSQSADTQGLLDAALSHFGRLDIVVNNAGTTHRNKPLLEITEAEFDRVYAVNVKSIFWS 121 Query: 137 CKAVLPQMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGIRVN 196 + ++P +QG G IIN+AST PG Y +K ++ ++A+ E P IRVN Sbjct: 122 ARHMVPYFRQQGGGCIINVASTAGVRPRPGLVWYNGSKGAVIIASKAMAAELGPDQIRVN 181 Query: 197 AIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPFIN 256 + P ET L ++ G D R++ P R +P ++A ++LASD+A FI Sbjct: 182 CVNPVIGETGLMTEFM-GMPDTPENRKKFLAGIPLGRFSKPQDIANACLYLASDDAEFIT 240 Query: 257 ASCITIDGGRSV 268 C+ +DGGR + Sbjct: 241 GVCLEVDGGRCI 252 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 252 Length adjustment: 25 Effective length of query: 247 Effective length of database: 227 Effective search space: 56069 Effective search space used: 56069 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory