Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate WP_052892752.1 PATSB16_RS19085 branched-chain amino acid ABC transporter ATP-binding protein/permease
Query= TCDB::Q55164 (267 letters) >NCBI__GCF_001931675.1:WP_052892752.1 Length = 598 Score = 184 bits (467), Expect = 4e-51 Identities = 111/271 (40%), Positives = 165/271 (60%), Gaps = 15/271 (5%) Query: 8 AENLG-----SPESSLLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFN 62 AE LG +P +L + K FGGL AV+ VK G I GLIGPNGAGK+T FN Sbjct: 327 AEALGRRDKPAPGEVILDVRAARKEFGGLVAVNDVSFQVKAGEIVGLIGPNGAGKSTTFN 386 Query: 63 LLSNFIRPDQGEVLFNGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLAD--QH 120 L++ ++ GE+ F+G+ I +LA +I RG RTFQ ++L ++VLEN+ + + Sbjct: 387 LVTGVLQATSGEITFHGERIDKLASREIVKRGIGRTFQHVRLLPTMSVLENVAIGAHLRD 446 Query: 121 QTGEKFLPRLINFRRVQKEERANREKAMAM------LESVGLGAKAQDYAGALSGGQRKL 174 + G + P+ + V + +RA E+AM M +E VGLG + AG+L+ GQ+++ Sbjct: 447 RQGLRRRPQGGVWSSVLRLDRA--EEAMLMHEAARQIERVGLGEHMYEEAGSLALGQQRI 504 Query: 175 LEMARALMSNPKLILLDEPAAGVNPTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCH 234 LE+ARAL +P L+LLDEPAAG+ + E + + +G++ L++EH+MD +M L Sbjct: 505 LEIARALACDPTLLLLDEPAAGLRYKEKQALAELLRKLSDEGMSVLLVEHDMDFVMNLTD 564 Query: 235 HVWVLAEGRNLADGTPEQIQSDPRVLEAYLG 265 H+ V+ G +A+G PE +Q DP VLEAYLG Sbjct: 565 HLVVMEFGTKIAEGLPEDVQKDPAVLEAYLG 595 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 598 Length adjustment: 31 Effective length of query: 236 Effective length of database: 567 Effective search space: 133812 Effective search space used: 133812 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory