Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_047214888.1 PATSB16_RS14950 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_001931675.1:WP_047214888.1 Length = 249 Score = 113 bits (282), Expect = 4e-30 Identities = 72/236 (30%), Positives = 123/236 (52%), Gaps = 3/236 (1%) Query: 7 LIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILF 66 L+ ++ + +HFGS+ A+ VS+ V PGE ++G NGAGK+TF +SG P+ G ILF Sbjct: 3 LLVVENVSRHFGSLRAVNEVSLTVEPGEMRAVIGPNGAGKTTFFNLISGFFPPSSGRILF 62 Query: 67 EGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIR--KIGPLKLFDHDYA 124 +GQ + + G+A Q + P ++V N + E ++ P Sbjct: 63 DGQDITEMGSHQRVTLGMARTFQITEIFPELTVRDNVRIPVEVEAGYRLSPWLSRAAKAR 122 Query: 125 NRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQT 184 R ++E+ +MG + G L G++++ I ++ ++L+LDEPT+ +G ++T Sbjct: 123 VRERVDELLEMGGLTAKANHVAGELPLGDQRSTEIIMSLALKPRLLLLDEPTAGMGDQET 182 Query: 185 ANVLATI-DKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAEE 239 +V I D R+QG+++V I H++R + R VL G+ L DI+A E Sbjct: 183 YDVTQLIRDLNRRQGLSMVLIEHDMRVIFQLAQRIMVLAEGQVLAEGTPADIAASE 238 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 151 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 249 Length adjustment: 24 Effective length of query: 237 Effective length of database: 225 Effective search space: 53325 Effective search space used: 53325 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory