Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_047216034.1 PATSB16_RS01005 ABC transporter ATP-binding protein
Query= uniprot:A0A165KC86 (260 letters) >NCBI__GCF_001931675.1:WP_047216034.1 Length = 257 Score = 377 bits (968), Expect = e-109 Identities = 184/256 (71%), Positives = 220/256 (85%) Query: 5 SNEVVLKVAGISKRFGGLQALSDVGITIKRGQVYGLIGPNGAGKTTFFNVITGLYTPDAG 64 S ++L V G++KRFGGLQAL+DVG+ IK G++YGLIGPNGAGKTTFFNVITGLY+PD+G Sbjct: 2 SENILLSVQGVNKRFGGLQALTDVGLEIKAGEIYGLIGPNGAGKTTFFNVITGLYSPDSG 61 Query: 65 TFELAGKPYEPTAVHEVAKAGIARTFQNIRLFAEMTALENVMVGRHIRTGSGLFGAVFRT 124 F L G+PY+PTAVHEVAKAGIARTFQNIRLF MTA+ENVMVGRH+RT +G++GA+ Sbjct: 62 KFVLGGQPYKPTAVHEVAKAGIARTFQNIRLFGGMTAVENVMVGRHVRTKTGVWGAITHH 121 Query: 125 KGFKAEEAAIAKRAQELLDYVGIGKFADYKARTLSYGDQRRLEIARALATDPQLIALDEP 184 G +AEE I +RA LL+YVG+ ++A Y + LSYG QRRLEIARALATDP+L+ALDEP Sbjct: 122 AGARAEEKGIYERAMALLEYVGVAQYAKYTSSNLSYGHQRRLEIARALATDPKLLALDEP 181 Query: 185 AAGMNATEKVQLRELIDRIRNDNRTILLIEHDVKLVMGLCDRVTVLDYGKQIAEGNPAEV 244 AAGMNATEKV+LR L+D+IR+D +TILLIEHDVKLVMGLC+R+TVLDYGK IA+G P +V Sbjct: 182 AAGMNATEKVELRGLLDKIRSDGKTILLIEHDVKLVMGLCNRMTVLDYGKVIAQGLPQDV 241 Query: 245 QKNEKVIEAYLGTGGH 260 QKN VIEAYLG GGH Sbjct: 242 QKNPAVIEAYLGAGGH 257 Lambda K H 0.319 0.137 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 257 Length adjustment: 24 Effective length of query: 236 Effective length of database: 233 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory