Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate WP_047214408.1 PATSB16_RS12290 triose-phosphate isomerase
Query= SwissProt::Q5SJR1 (250 letters) >NCBI__GCF_001931675.1:WP_047214408.1 Length = 259 Score = 228 bits (582), Expect = 7e-65 Identities = 122/243 (50%), Positives = 160/243 (65%), Gaps = 4/243 (1%) Query: 5 LVAGNWKMHKTPSEARVWFAEL--KRLLPPLQSEAAVLPAFPILPVAKEVLAETQVGYGA 62 LV GNWK+H + + A L +L ++ AV FP L +++L + + +GA Sbjct: 15 LVVGNWKLHGSLAANAELLARLLASPVLAQGRAVTAVCVPFPYLAQCQQLLGGSPLAWGA 74 Query: 63 QDVSAHKEGAYTGEVSARMLSDLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGITP 122 QDVSA GA+TGEVSA M+ + G Y +VGHSERR YHGETDALVA K R+L G+TP Sbjct: 75 QDVSAEINGAFTGEVSAPMIGEFGSSYVLVGHSERRAYHGETDALVAAKTGRVLAAGMTP 134 Query: 123 ILCVGEPLEVREKGEAVPYTLRQLRGSLEGVEPPGPEALVIAYEPVWAIGTGKNATPEDA 182 I+CVGE L R+ G+ RQL L ++ P +V+AYEPVWAIGTGK AT E A Sbjct: 135 IVCVGETLAQRDAGQTDAVVERQLGAVLAALDVPQAARIVVAYEPVWAIGTGKTATREQA 194 Query: 183 EAMHQAIRKALSERYGEAFASRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELESF 242 +A+H+ +R L+ + GE A V+ILYGGSV P N ADL +MP++DGGL+GGASL+ E F Sbjct: 195 QAVHERLRAQLAAKGGEVAA--VKILYGGSVKPDNAADLFAMPDIDGGLIGGASLKAEDF 252 Query: 243 LAL 245 LA+ Sbjct: 253 LAI 255 Lambda K H 0.317 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 250 Length of database: 259 Length adjustment: 24 Effective length of query: 226 Effective length of database: 235 Effective search space: 53110 Effective search space used: 53110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
Align candidate WP_047214408.1 PATSB16_RS12290 (triose-phosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00419.hmm # target sequence database: /tmp/gapView.2158792.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00419 [M=228] Accession: TIGR00419 Description: tim: triose-phosphate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-64 201.6 0.4 9.2e-64 201.4 0.4 1.0 1 NCBI__GCF_001931675.1:WP_047214408.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_001931675.1:WP_047214408.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 201.4 0.4 9.2e-64 9.2e-64 1 228 [] 15 250 .. 15 250 .. 0.94 Alignments for each domain: == domain 1 score: 201.4 bits; conditional E-value: 9.2e-64 TIGR00419 1 lviinfKlnesvgkvelevaklae.evaseagvevavappfvdldvvkdeve.seiqvaAqnvdavksGaftG 71 lv++n+Kl++s+ ++++a+l + v + av +pf +l ++ + s + +Aq+v a GaftG NCBI__GCF_001931675.1:WP_047214408.1 15 LVVGNWKLHGSLAANAELLARLLAsPVLAQGRAVTAVCVPFPYLAQCQQLLGgSPLAWGAQDVSAEINGAFTG 87 79*******************988567666667779***************9999****************** PP TIGR00419 72 eisAemlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvattaaa 144 e+sA m+ ++G +vl+gHsErR+++ e+d l+++k r+ + g++++vCvgetl++r+a++t +v ++ +a NCBI__GCF_001931675.1:WP_047214408.1 88 EVSAPMIGEFGSSYVLVGHSERRAYHGETDALVAAKTGRVLAAGMTPIVCVGETLAQRDAGQTDAVVERQLGA 160 ************************************************************9998888888777 PP TIGR00419 145 aA.......lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasvtaaedaela 210 + vvA+EPv++iGtGk++++ +a++v++ +r l+ eva v++lyG+sv+ ++a+l+ NCBI__GCF_001931675.1:WP_047214408.1 161 VLaaldvpqAARIVVAYEPVWAIGTGKTATREQAQAVHERLRAQLAAKGGEVA-AVKILYGGSVKPDNAADLF 232 5336777767789********************************99999*98.6****************** PP TIGR00419 211 aqldvdGvLlasavlkae 228 a +d+dG L+++a+lkae NCBI__GCF_001931675.1:WP_047214408.1 233 AMPDIDGGLIGGASLKAE 250 ****************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (228 nodes) Target sequences: 1 (259 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 17.34 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory