Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate WP_052892752.1 PATSB16_RS19085 branched-chain amino acid ABC transporter ATP-binding protein/permease
Query= TCDB::P0A9S7 (255 letters) >NCBI__GCF_001931675.1:WP_052892752.1 Length = 598 Score = 200 bits (508), Expect = 7e-56 Identities = 108/257 (42%), Positives = 159/257 (61%), Gaps = 11/257 (4%) Query: 5 LLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGTILL 64 +L V FGGL+AVN+V+ ++ EIV LIGPNGAGK+T FN +TG + T G I Sbjct: 342 ILDVRAARKEFGGLVAVNDVSFQVKAGEIVGLIGPNGAGKSTTFNLVTGVLQATSGEITF 401 Query: 65 RDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGL--------FSG 116 + ++ L ++I + G+ RTFQHVRL M+V+EN+ + H + + GL +S Sbjct: 402 HGERIDKLASREIVKRGIGRTFQHVRLLPTMSVLENVAIGAHLRDRQGLRRRPQGGVWSS 461 Query: 117 LLKTPSFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILM 176 +L+ R ++ + AA +ER+GL EH +A +LA G QR LEIAR + P +L+ Sbjct: 462 VLRLD--RAEEAMLMHEAARQIERVGLGEHMYEEAGSLALGQQRILEIARALACDPTLLL 519 Query: 177 LDEPAAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANG 236 LDEPAAGL KE + L EL+ +L + ++LL+EHDM VM ++D + V+ GT +A G Sbjct: 520 LDEPAAGLRYKEKQALAELLRKL-SDEGMSVLLVEHDMDFVMNLTDHLVVMEFGTKIAEG 578 Query: 237 TPEQIRNNPDVIRAYLG 253 PE ++ +P V+ AYLG Sbjct: 579 LPEDVQKDPAVLEAYLG 595 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 344 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 598 Length adjustment: 30 Effective length of query: 225 Effective length of database: 568 Effective search space: 127800 Effective search space used: 127800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory