Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate WP_075617736.1 GY23_RS03100 amino acid ABC transporter permease
Query= SwissProt::P0AER5 (224 letters) >NCBI__GCF_001939075.1:WP_075617736.1 Length = 225 Score = 133 bits (334), Expect = 3e-36 Identities = 73/221 (33%), Positives = 129/221 (58%), Gaps = 8/221 (3%) Query: 4 FDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNVF 63 FD + SLPY+L G+ TL I++ ++ +G+ G LA+ R S FA + W A+ Y++ Sbjct: 10 FDPQLAIDSLPYVLGGIWFTLLISLVSMAVGLFIGFFLALARTSHFAVLQWPARLYISFM 69 Query: 64 RSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGIQSI 123 R +P++++L Y P V+G+ + +A++ FSM AAY +EI R+ + S+ Sbjct: 70 RGVPILVILFLLYFGFP-----VIGIE---FTAIQAALIGFSMNSAAYMAEIFRSSLSSV 121 Query: 124 SRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFRT 183 GQ ++ ALGM +WQ+MK IILPQ+ R +P L + L + +SL ++++ + F+ Sbjct: 122 DIGQWESSKALGMNYWQTMKRIILPQSVRIAIPPLSNVLMDLIKASSLAAMITVPEMFQK 181 Query: 184 ASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA 224 A +G R+ + +I+ +Y+ I ++L +YL++R A Sbjct: 182 ARIVGAREYDLLTVIILVALLYWAICSIMTVLQNYLEKRYA 222 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 225 Length adjustment: 22 Effective length of query: 202 Effective length of database: 203 Effective search space: 41006 Effective search space used: 41006 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory