Align ABC transporter for L-Arginine and L-Citrulline, permease component 1 (characterized)
to candidate WP_139311101.1 GY23_RS08105 ABC transporter permease subunit
Query= reanno::pseudo1_N1B4:Pf1N1B4_3432 (229 letters) >NCBI__GCF_001939075.1:WP_139311101.1 Length = 233 Score = 113 bits (283), Expect = 3e-30 Identities = 73/213 (34%), Positives = 111/213 (52%), Gaps = 13/213 (6%) Query: 9 ILDG-VWLTLQLALSSMVLAIVLGLIGVALRLSPIRWLAWLGDLYSTVIRGIPDLVLILL 67 +L+G V TL L L + VL + L ++ R+S I+ L W+ Y + IRG P LV + + Sbjct: 27 LLEGAVVYTLPLTLITFVLGLTLAILTALARISTIKPLQWIARFYVSAIRGTPLLVQLFI 86 Query: 68 IFYGGQDLLNRVAPMFGYDDYIDLNPLAAGIGTLGFIFGAYLSETFRGAFMAIPKGQAEA 127 +FYG L V I ++P A + GAY SE R A ++IPKGQ EA Sbjct: 87 LFYG----LGSVG--------IVIDPFPAAVIGFSLNVGAYASEVIRAAILSIPKGQWEA 134 Query: 128 GMAYGMSSFQVFFRVLVPQMIRLAIPGFTNNWLVLTKATALISVVGLQDMMFKAKQAADA 187 GMS Q RV++PQ R++IP +N ++ L K T+L S + + +M +A++ A Sbjct: 135 AQMIGMSYSQTLRRVILPQATRVSIPPLSNTFIGLVKDTSLASAILVTEMFRRAQEIAAF 194 Query: 188 TREPFTFFLAVAAMYLVITSVSLLALRHLEKRY 220 E + VA +Y +I + L LE+R+ Sbjct: 195 NYEVLLLYTEVAILYWIICFLLSLVQGRLERRF 227 Lambda K H 0.329 0.144 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 229 Length of database: 233 Length adjustment: 23 Effective length of query: 206 Effective length of database: 210 Effective search space: 43260 Effective search space used: 43260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory