Align fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_075618829.1 GY23_RS08840 sugar kinase
Query= BRENDA::Q6VWJ5 (386 letters) >NCBI__GCF_001939075.1:WP_075618829.1 Length = 321 Score = 157 bits (397), Expect = 4e-43 Identities = 102/322 (31%), Positives = 172/322 (53%), Gaps = 15/322 (4%) Query: 68 VVCFGEMLIDFVPTTSGLSLAEAPAFKKAPGGAPANVAVGISRLGGSSAFIGKVGEDEFG 127 ++ GE ++ F G L F K GGA +NVA+G++RLG S+ FI +VG++EFG Sbjct: 7 LITIGETMVLFEAAADG-PLQYIHQFNKKCGGAESNVAIGVTRLGHSAGFISQVGDEEFG 65 Query: 128 YMLAEILKENNVNSDGMRFDPGARTALAFVTLRKDGEREFMFYRNPSADMLLQEDELDLE 187 + ++ V++ ++ + T L ++G + +YR SA ++++ELD E Sbjct: 66 KFVISSIRGEGVDTSRVKINEDFSTGLYIKETLREGSNQVYYYRKGSAASQMKKEELDWE 125 Query: 188 LIRKAKVFHYGSIS-LITEPCKSAHIAAAKAAKDAGVILSYDPNLRLPLWPSAESAREGI 246 +R+AKV H I+ +++ C+ A A+ AK+ ++LS+DPN+R L A++ + Sbjct: 126 YLRQAKVIHLTGITPFLSDSCEELIYAVAEFAKENNILLSFDPNIRYKLMSDKPDAKDIV 185 Query: 247 LSIWNTADIIKISEEEISFLTQGEDPYDDNVVRKLYHPNLKLLLVTEGPEGCRYYTK-DF 305 L I AD++ +E +L G Y++ + + + + + + G G Y +K D Sbjct: 186 LKIAKLADLVMPGIDEAEYLL-GTRDYNE-IAQYFLNAGVSKIAIKNGDIGTYYDSKEDE 243 Query: 306 SGRVKGIKVD-AVDTTGAGDAFVAGILSQLASDVSLLQDEGK-LRDALSFANACGALTVM 363 +G + IKVD VD GAGD F AG+LS L EGK L++A++ + GA+ V Sbjct: 244 AGFIPSIKVDRVVDPIGAGDGFAAGLLSGLL--------EGKSLKEAVTMGSTIGAMVVT 295 Query: 364 ERGAIPALPTKEVVLNTLLKSV 385 +G + LP +E + N KSV Sbjct: 296 VKGDVEGLPRREALENFHRKSV 317 Lambda K H 0.317 0.134 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 321 Length adjustment: 29 Effective length of query: 357 Effective length of database: 292 Effective search space: 104244 Effective search space used: 104244 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory