Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_075617526.1 GY23_RS01955 3-oxoacyl-[acyl-carrier-protein] reductase
Query= BRENDA::Q1J2J0 (255 letters) >NCBI__GCF_001939075.1:WP_075617526.1 Length = 248 Score = 156 bits (395), Expect = 3e-43 Identities = 99/250 (39%), Positives = 147/250 (58%), Gaps = 20/250 (8%) Query: 15 RLDGRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGTFE------- 67 +L+G+ A+VTG ++GIG EIA+ LA+ GARV + N + A E+ E Sbjct: 3 KLNGKTAIVTGASRGIGAEIAKYLAKEGARVIV---NYSGSQSKAEEVVKEIEAFGGEAL 59 Query: 68 --RLNVTDADAVADLA----RRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGV 121 + +V+DAD+V L +D+LVNNAGI R+ +++W V++ NL GV Sbjct: 60 AVQASVSDADSVTALISATMEHFGSIDILVNNAGITRDNLIMRMKENEWDDVINTNLKGV 119 Query: 122 FWCCREFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASR 181 F C + R M+ + G IV+ AS+ G+ N QA Y A+KA VI LT++ A E ASR Sbjct: 120 FLCTKAVTRQMMKQRAGRIVNIASIVGVSGN--AGQANYVAAKAGVIGLTKTTAKELASR 177 Query: 182 GVRVNAVAPGYTATPLTRRGLETPEWRETWLKETPLGRLAEPREIAPAVLYLASDAASFV 241 + VNA+APG+ +T +T E E + L + PL +L P ++A AV++LASD ++++ Sbjct: 178 NINVNAIAPGFISTEMTADLPE--EVKAQMLTQIPLAKLGNPEDVAKAVIFLASDDSNYI 235 Query: 242 TGHTLVVDGG 251 TG TL VDGG Sbjct: 236 TGQTLHVDGG 245 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 150 Number of extensions: 5 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 248 Length adjustment: 24 Effective length of query: 231 Effective length of database: 224 Effective search space: 51744 Effective search space used: 51744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory