Align glycolate oxidase subunit glcD (characterized)
to candidate WP_075972905.1 BJP25_RS01440 FAD-binding protein
Query= CharProtDB::CH_024646 (499 letters) >NCBI__GCF_001940455.1:WP_075972905.1 Length = 453 Score = 211 bits (538), Expect = 3e-59 Identities = 148/433 (34%), Positives = 216/433 (49%), Gaps = 18/433 (4%) Query: 45 ECDGLSAYRTRPLLVVLPKQMEQVTAILAVCHRLRVPVVTRGAGTGLSGGALPLEKGVLL 104 EC L+ P VV P+ EQV A+L PV RG+GTGLSG A+P G+++ Sbjct: 28 EC--LTVAGREPAHVVRPETAEQVAAVLKAASEAGTPVTARGSGTGLSGAAVPSPGGIVV 85 Query: 105 VMARFKEILDINPVGRRARVQPGVRNLAISQAVAPHNLYYAPDPSSQIACSIGGNVAENA 164 R +L+I+ A VQPGV + A H L Y P +++ S+GGN+A NA Sbjct: 86 SFERMNAVLEIDTDNHVAVVQPGVTLQELDARTAEHGLVYPVYP-GELSASLGGNIATNA 144 Query: 165 GGVHCLKYGLTVHNLLKIEVQTLDGEAL-TLGSDALDSPGFDLLALFTGSEGMLGVTTEV 223 GG+ +K+G+T H++L ++ GE + T G A S G+DL L GSEG L + TE Sbjct: 145 GGMRAVKHGVTRHHVLGLQAALPTGELIRTGGKFAKASTGYDLTQLIVGSEGTLALVTEA 204 Query: 224 TVKLLPKPPVARVLLASFDSVEKAGLAVGDIIANGIIPGGLEMMDNLSIRAAEDF--IHA 281 +KL P+ +LA F + + AV ++ +G+ P LE +D +++ A + Sbjct: 205 VLKLQPRVAHQATVLAPFAGLPEVTRAVPRVVGSGLQPQVLEYIDGMTMAAITHTADLQL 264 Query: 282 GYP----VDAEAILLCELDG-VESDVQEDCERVNDILLKAGATDVRLAQDEAERVRFWAG 336 G P A+A L+ LDG + + ED E V +L + GA D + + R + Sbjct: 265 GIPDAVRESAQAYLVVVLDGRTQERLDEDVEAVAQLLSELGAVDAYVLPAGSAR-KLIEA 323 Query: 337 RKNAFPAVGRISPDYYCMDGTIPRRALPGVLEGIARLSQQYDLRVANVFHAGDGNMHPLI 396 R+ AF D +D IPR ALP + + ++Q + V HAGDGN+H L Sbjct: 324 RERAFYTAKAAGAD-DIIDTVIPRAALPEFMTRVTAIAQAHQTFVIGCGHAGDGNVH-LA 381 Query: 397 LFDANEPGEFARAEELGGKILELCVEVGGSISGEHGIGREKINQMCAQFNSDEITTFHAV 456 +F + EL + L GG+ISGEHGIG K A + ++ + Sbjct: 382 VFQKDTATRSTVLHELFAAAMAL----GGAISGEHGIGHAKREHFLALEDPAKVELMRRL 437 Query: 457 KAAFDPDGLLNPG 469 K AFDP G+LNPG Sbjct: 438 KQAFDPAGVLNPG 450 Lambda K H 0.320 0.140 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 610 Number of extensions: 27 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 453 Length adjustment: 33 Effective length of query: 466 Effective length of database: 420 Effective search space: 195720 Effective search space used: 195720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory