Protein WP_075662983.1 in Corynebacterium frankenforstense ST18
Annotation: NCBI__GCF_001941485.1:WP_075662983.1
Length: 534 amino acids
Source: GCF_001941485.1 in NCBI
Candidate for 48 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| L-fucose catabolism | HSERO_RS05250 | hi | Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale) | 45% | 97% | 427.9 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| myo-inositol catabolism | PS417_11890 | med | Inositol transport system ATP-binding protein (characterized) | 45% | 94% | 414.1 | Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR | 45% | 411.0 |
| D-cellobiose catabolism | mglA | med | Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 45% | 99% | 411 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-glucose catabolism | mglA | med | Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 45% | 99% | 411 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| lactose catabolism | mglA | med | Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 45% | 99% | 411 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-maltose catabolism | mglA | med | Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 45% | 99% | 411 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| sucrose catabolism | mglA | med | Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 45% | 99% | 411 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| trehalose catabolism | mglA | med | Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 45% | 99% | 411 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-xylose catabolism | xylG | med | Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) | 45% | 99% | 411 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| myo-inositol catabolism | iatA | med | Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) | 44% | 99% | 403.7 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-mannose catabolism | HSERO_RS03640 | med | Ribose import ATP-binding protein RbsA; EC 7.5.2.7 (characterized, see rationale) | 42% | 98% | 397.9 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-arabinose catabolism | araG | med | L-arabinose ABC transporter, ATP-binding protein AraG; EC 3.6.3.17 (characterized) | 42% | 99% | 394.4 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-ribose catabolism | rbsA | med | ribose transport, ATP-binding protein RbsA; EC 3.6.3.17 (characterized) | 44% | 98% | 389.4 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-galactose catabolism | mglA | med | Galactose/methyl galactoside import ATP-binding protein MglA aka B2149, component of Galactose/glucose (methyl galactoside) porter (characterized) | 40% | 99% | 386 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-galactose catabolism | BPHYT_RS16930 | med | Arabinose import ATP-binding protein AraG; EC 7.5.2.12 (characterized, see rationale) | 42% | 98% | 385.6 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-arabinose catabolism | gguA | med | GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized) | 43% | 99% | 384.8 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-galactose catabolism | gguA | med | GguA aka ATU2347 aka AGR_C_4264, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized) | 43% | 99% | 384.8 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-fructose catabolism | frcA | med | ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) | 42% | 98% | 381.3 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| sucrose catabolism | frcA | med | ABC-type sugar transport system, ATP-binding protein; EC 3.6.3.17 (characterized, see rationale) | 42% | 98% | 381.3 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-rhamnose catabolism | rhaT' | med | RhaT, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized) | 42% | 95% | 375.6 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-xylose catabolism | xylK_Tm | med | Ribose import ATP-binding protein RbsA 1; EC 7.5.2.7 (characterized, see rationale) | 42% | 96% | 374.8 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| xylitol catabolism | PS417_12065 | med | D-ribose transporter ATP-binding protein; SubName: Full=Putative xylitol transport system ATP-binding protein; SubName: Full=Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 41% | 99% | 367.9 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-galactose catabolism | ytfR | lo | galactofuranose ABC transporter putative ATP binding subunit (EC 7.5.2.9) (characterized) | 40% | 97% | 368.6 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-arabinose catabolism | araVsh | lo | ABC transporter related (characterized, see rationale) | 39% | 98% | 365.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-fructose catabolism | fruK | lo | Fructose import ATP-binding protein FruK; EC 7.5.2.- (characterized) | 39% | 100% | 364 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| sucrose catabolism | fruK | lo | Fructose import ATP-binding protein FruK; EC 7.5.2.- (characterized) | 39% | 100% | 364 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| 2'-deoxyinosine catabolism | H281DRAFT_01113 | lo | deoxynucleoside transporter, ATPase component (characterized) | 40% | 99% | 339 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-fucose catabolism | BPHYT_RS34245 | lo | ABC transporter related; Flags: Precursor (characterized, see rationale) | 38% | 97% | 325.5 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-rhamnose catabolism | BPHYT_RS34245 | lo | ABC transporter related; Flags: Precursor (characterized, see rationale) | 38% | 97% | 325.5 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| 2'-deoxyinosine catabolism | nupA | lo | Purine/cytidine ABC transporter ATP-binding protein, component of General nucleoside uptake porter, NupABC/BmpA (transports all common nucleosides as well as 5-fluorocytidine, inosine, deoxyuridine and xanthosine) (Martinussen et al., 2010) (Most similar to 3.A.1.2.12). NupA is 506aas with two ABC (C) domains. NupB has 8 predicted TMSs, NupC has 9 or 10 predicted TMSs in a 4 + 1 (or 2) + 4 arrangement (characterized) | 37% | 98% | 306.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| myo-inositol catabolism | PGA1_c07320 | lo | Inositol transport system ATP-binding protein (characterized) | 37% | 93% | 157.5 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-arabinose catabolism | xylGsa | lo | Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) | 35% | 95% | 153.3 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-mannose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 32% | 97% | 141 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| D-ribose catabolism | frcA | lo | Fructose import ATP-binding protein FrcA; EC 7.5.2.- (characterized) | 32% | 97% | 141 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-isoleucine catabolism | livG | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 93% | 125.9 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-leucine catabolism | livG | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 93% | 125.9 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-phenylalanine catabolism | livG | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 93% | 125.9 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-proline catabolism | HSERO_RS00895 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 93% | 125.9 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-serine catabolism | Ac3H11_1693 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 93% | 125.9 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-tyrosine catabolism | Ac3H11_1693 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 31% | 93% | 125.9 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-arginine catabolism | braF | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 32% | 85% | 123.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-glutamate catabolism | braF | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 32% | 85% | 123.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-histidine catabolism | braF | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 32% | 85% | 123.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-valine catabolism | livG | lo | ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) | 32% | 85% | 123.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-phenylalanine catabolism | livF | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 81% | 93.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-proline catabolism | HSERO_RS00900 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 81% | 93.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-serine catabolism | Ac3H11_1692 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 81% | 93.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
| L-tyrosine catabolism | Ac3H11_1692 | lo | ABC transporter ATP-binding protein (characterized, see rationale) | 33% | 81% | 93.2 | Inositol transport system ATP-binding protein | 45% | 414.1 |
Sequence Analysis Tools
View WP_075662983.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MTAPDTAPLIELRHVSKSFGPVRVIDDVSVAVRPGQVQALLGENGAGKSTIIKMMAGVHE
PDSGEILVDGEPVRIPDTKTAESFGIATIYQELNLVPTLSVAENIMLGRTPARGGLVNFT
ELRRRAAEALDRVGLEADLDTPVGELSVARQQLVEIAKALSTNARILILDEPTASLTGHE
IDQLFRVVDELKAAGVGMVFISHHLDEIARISDSVSVLRDGSFVAEVAPDTEEAEFVRLM
VGRDIDDQYPRQAGTPGEPLLVVEHLSSDGKFEDVSLTVRGGEVVGVAGLVGAGRTELVR
AIAGADSYDSGTVTVRGKKLRKGDVKGAIDHGVGLVPEDRKNQGLVLDASVGENIGLATL
SSSATAGLADLKGQRTLANSVAEKLRVRMAGIDQPVRDLSGGNQQKAVFGKWVMANSMVL
LLDEPTRGVDVGAKVEIYNIINTLTAAGGGVLMVSSDLPEVLGMSDRILVMSGGRLAGEL
TPEATQDEVMTLAVSRLSDATDSTDSDSTGTTSTDTTDTAGRTGTDTAEKENQQ
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory