GapMind for catabolism of small carbon sources

 

Protein WP_083666824.1 in Corynebacterium frankenforstense ST18

Annotation: NCBI__GCF_001941485.1:WP_083666824.1

Length: 586 amino acids

Source: GCF_001941485.1 in NCBI

Candidate for 12 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-mannose catabolism TM1750 med TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 47% 78% 238.4 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
D-mannose catabolism TM1749 med TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 43% 80% 221.1 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
D-cellobiose catabolism cbtD lo CbtD, component of Cellobiose and cellooligosaccharide porter (characterized) 33% 71% 157.1 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
putrescine catabolism potA lo Spermidine/putrescine import ATP-binding protein PotA, component of The spermidine/putrescine uptake porter, PotABCD (characterized) 36% 64% 147.5 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
D-cellobiose catabolism TM0028 lo TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 35% 78% 145.6 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
D-cellobiose catabolism TM0027 lo TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized) 35% 89% 139.4 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 34% 91% 128.3 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 32% 60% 106.7 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
L-isoleucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 87% 86.7 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
L-leucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 87% 86.7 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
L-proline catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 87% 86.7 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0
L-valine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 30% 87% 86.7 Glutathione import ATP-binding protein GsiA; EC 7.4.2.10 41% 406.0

Sequence Analysis Tools

View WP_083666824.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSHPIDNGNSANTTRTAPEGATREPAPDTPLLEVDDLHVSFTSSTGVVEAVRGFNLTVYP
GQSVAIVGESGSGKSTAAMSLLGLLPGTGKVTGGSIRFDGEELVGLSDKEMQHYRGSEIG
LVPQDPMSNLNPVWRIGTQVAEALKANNVVPHSEIGDRVDQLLEEAGLEGGGGRARQYPH
EFSGGMRQRALIAIGLAANPRLLIADEPTSALDVTVQKRILDHLGRLAREHHTAVLFITH
DLGLAAERAEHLVVMHRGRIVESGPSLDILRDPQHPYTRRLVKAAPSLASARIQTAREQG
KVTDEMLAKTVAADDGEVDKVIEVKGLTKEFDVRGRKGEKKTLRAVDDVSFYVRRGTTTA
LVGESGSGKSTVANMVLGLLQPTAGKVYLGGRDLDELSPKEKFAVRRRMQVVFQNPYGSL
DPMFSVYRCIEEPLTTHKVGSRREREQKVAELLDKVSLPRSAMRRYPNELSGGQRQRVAI
ARALALDPEVLVLDEAVSALDVLVQNQILTLLAGLQRDLGLSYLFITHDLGVVRQTADDV
VVMEKGRLVEKGGVDQIFDAPAHDYTLNLIEAVPGLGIELGTGEHL

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory