Align Citrate/succinate antiporter; Citrate carrier; Citrate transporter (characterized)
to candidate WP_083666788.1 CFRA_RS02540 DASS family sodium-coupled anion symporter
Query= SwissProt::P0AE74 (487 letters) >NCBI__GCF_001941485.1:WP_083666788.1 Length = 493 Score = 301 bits (771), Expect = 3e-86 Identities = 167/481 (34%), Positives = 254/481 (52%), Gaps = 16/481 (3%) Query: 10 KLLAPLVVMGVMFLIPVPDGMPPQAWHYFAVFVAMIVGMILEPIPATAISFIAVTICVIG 69 +L A + V V++ +P PDG+ AW FA+FVA I+ +IL P +S +A+ C Sbjct: 25 RLAAAVGVGLVLWFVPTPDGLADNAWGLFALFVATILMIILNAAPMGTVSVVAMAACAAT 84 Query: 70 SNYLLFDAKELADPAFNAQKQALKWGLAGFSSTTVWLVFGAFIFALGYEVSGLGRRIALF 129 DP ++ L+GFS++T+WL+ AF A SGLG R+ Sbjct: 85 G------VLAPGDPG-----ASITAALSGFSNSTIWLIVSAFFIARAVIASGLGARLGYL 133 Query: 130 LVKFMGKRTLTLGYAIVIIDILLAPFTPSNTARTGGTVFPVIKNLPPLFKSFPNDPSARR 189 V+ G+ TL L Y + + D++ +P PSNTAR GG V+PV++++ P DP+ R Sbjct: 134 FVRIFGRSTLGLAYGLGLADLVTSPAIPSNTARAGGIVYPVMESILKTDGVDPADPATHR 193 Query: 190 IGGYLMWMMVISTSLSSSM-FVTGAAPNVLGLEFVSKIAGIQISWLQWFLCFLPVGVILL 248 + + + L++S+ F TGAAPN LG + ++ SW WFL G+I Sbjct: 194 RMASFLAISTYNLDLAASVIFFTGAAPNALGTKLADQMGVDTPSWGGWFLLACVPGIIGF 253 Query: 249 IIAPWLSYVLYKPEITHSEEVATWAGDELKTMGALTRREWTLIGLVLLSLGLWVFGSEVI 308 I P + Y+LY+PE + A L +G + RE +G+ + + LWV G + Sbjct: 254 IAVPLVLYLLYRPEARKTPHAPQEAARRLAALGPMATREKITLGVFVTVIALWVAGGSWL 313 Query: 309 NATAVGLLAVSLMLALHVVPWKDITRYNSAWNTLVNLATLVVMANGLTRSGFIDWFAGTM 368 N T V + ++L+L V+ W D+ SAW+TLV A LV+M + L +GFIDW G + Sbjct: 314 NPTTVAFIGLALLLLCGVLTWSDVKGERSAWDTLVWFAALVMMGSQLNETGFIDWLGGLV 373 Query: 369 STHLEGFSPNATVIVLVLVFYFAHYLFASLSAHTATMLPVILAVGKGIPGVPMEQLCILL 428 L G P + L +V+ +HYLFAS +AHTA M V L G + G+P L ++L Sbjct: 374 EGPLGGLDPTVAFVALTVVYAASHYLFASGTAHTAAMFSVFLGTGVAL-GLPALPLIVIL 432 Query: 429 VLSIGIMGCLTPYATGPGVIIYGCGYVKSKDYWRLGAIFGVIYISMLLLVG---WPILAM 485 +MGCLT Y GP + +G GYV +W LGA+ G++++++ L VG W ++ Sbjct: 433 AALPTLMGCLTHYGNGPAPLYFGTGYVPVGRWWSLGAVIGLVHLAVWLGVGPLWWQLIGA 492 Query: 486 W 486 W Sbjct: 493 W 493 Lambda K H 0.328 0.142 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 849 Number of extensions: 47 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 487 Length of database: 493 Length adjustment: 34 Effective length of query: 453 Effective length of database: 459 Effective search space: 207927 Effective search space used: 207927 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory