Align iron(III) dicitrate transport ATP-binding protein FecE (characterized)
to candidate WP_075858469.1 cpu_RS02745 ATP-binding cassette domain-containing protein
Query= CharProtDB::CH_088321 (255 letters) >NCBI__GCF_001950255.1:WP_075858469.1 Length = 399 Score = 150 bits (379), Expect = 4e-41 Identities = 89/251 (35%), Positives = 138/251 (54%), Gaps = 1/251 (0%) Query: 3 LRTENLTVSYGTDKVLNDVSLSLPTGKITALIGPNGCGKSTLLNCFSRLLMPQSGTVFLG 62 L+ NL YG+ K+ +++ + G + ++GPNG GK+TLL + L P++GTV + Sbjct: 2 LKGINLVFGYGSAKLFAGINIEVLPGTFSVILGPNGAGKTTLLKILAGFLKPKNGTVEIK 61 Query: 63 DNPINMLSSRQLARRLSLLPQHHLTPEGITVQELVSYGRNPWLSLWGRLSAEDNARVNVA 122 I L ++ A+ L+ +PQ T TV + V GR P+ + G + D V A Sbjct: 62 GKEILKLPAKARAKLLAYVPQEPETLRDYTVWDTVMMGRYPYQGVLGLETKADFKAVKKA 121 Query: 123 MNQTRINHLAVRRLTELSGGQRQRAFLAMVLAQNTPVVLLDEPTTYLDINHQVDLMRLMG 182 + ++ R L LSGG+RQR ++A LAQ +LLDEPT +LD+ +QV ++ L+ Sbjct: 122 IETVGLSGYEERTLLTLSGGERQRVYIARALAQEADYILLDEPTNHLDLFYQVKILSLLK 181 Query: 183 ELRTQGKTVVAVLHDLNQASRYCDQLVVMANGHVMAQGTPEEVMTPGLLRTVFSVEAEIH 242 L QG V+AVLHDLN AS + D+L + + G ++ G +EV+T + +S A + Sbjct: 182 NLAAQGIAVLAVLHDLNLASFFADKLYLFSEGKLIT-GEAKEVLTFENIYKAYSEPALVV 240 Query: 243 PEPVSGRPMCL 253 PV G P L Sbjct: 241 NHPVLGIPQIL 251 Lambda K H 0.320 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 5 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 399 Length adjustment: 27 Effective length of query: 228 Effective length of database: 372 Effective search space: 84816 Effective search space used: 84816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory