Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.110) (characterized)
to candidate WP_076582863.1 BB347_RS14425 FAD-binding oxidoreductase
Query= BRENDA::H6LBS1 (466 letters) >NCBI__GCF_001971705.1:WP_076582863.1 Length = 467 Score = 238 bits (606), Expect = 4e-67 Identities = 151/454 (33%), Positives = 239/454 (52%), Gaps = 11/454 (2%) Query: 14 IKELIPAERVFVGTEIGEDFSHDELGSIHSYPEVLIKVTSTEEVSKIMKYAYEHNIPVVV 73 +++ + RV + E ++ D P+ ++ STEEV+ ++ A + IPV Sbjct: 14 LEDAVEDGRVAYEASVREQYAEDASPHAGRLPDAVVWPASTEEVAAVLSAANDREIPVTP 73 Query: 74 RGSGTGLVGACVPLFGGIMLETTLMNNILELDTENLTVTVEPGVLLMELSKFVEENDLFY 133 G+GL G +P GGI+L T ++ I + ++L TV GV+ +L++ + ++ L + Sbjct: 74 WSGGSGLEGNAIPASGGIVLTTADLDQI-SVSPDDLHATVGAGVVYDDLNEHLAQHGLRF 132 Query: 134 PPDPGEKS-ATIAGNISTNAGGMRAVKYGVTRDYVRGLTVVLANGEIIELGGKIVKNSSG 192 P AT+ G ++TNA G AV+YG TR++VR L VV A+G I+E G +VK S+G Sbjct: 133 APGISSGDIATLGGMVATNASGFNAVRYGETRNHVRRLEVVTADGRIVECGRDVVKTSAG 192 Query: 193 YSLKDLVIGSEGTLCVITKAILKLLPLPKMTLSLLIPFENISDAAGIVPKIIKSKAIPTA 252 YSLKDL+IGSEGTL V+T+ + L+ +P+ + L+ F + DA+ V I S +P A Sbjct: 193 YSLKDLIIGSEGTLGVVTEVTVGLVGVPEHRRAALVTFPSREDASRAVSDAIGSALVPGA 252 Query: 253 IEFMERQTILFAEDFLGKKFPDSSSNAYILLTFDGNTKEQVEAEYETVANLCLAEGAKDV 312 IEFM+R +I + + +L+ N + +E + +C G + Sbjct: 253 IEFMDRMSIRMLNAYHDDL--EFEEQPTLLIELHAN-NDGIEEDLAFAKLICEDHGMES- 308 Query: 313 YIVDTVERKDSVWSARGAFLEAIKASTTEMDEC---DVVVPRNRIAEFIEFTHDLAKEMD 369 + E D +W AR A + E + DVVVP + + ++ D +++D Sbjct: 309 WTAAAEENIDDIWQARRDKYWATTSYREEWEVALVGDVVVPISNYPDIVQEVSDAGEDLD 368 Query: 370 VRIPSFGHAGDGNLHIYVCRDELCQADWEAKLAEAMDRMYAKALTFEGLVSGEHGIGYAK 429 + + GHAGDGNLH Y + + A+ E +R+ +KAL G +GEHG+G K Sbjct: 369 LTVSCVGHAGDGNLH-YTPLVDPDDEEMVARAHELNERVVSKALELGGSATGEHGVGIGK 427 Query: 430 RKYLLNDFGTEHLALMAGIKQTFDPKNLLNPKKV 463 RK++ + G L LM IK T DPK +LNP KV Sbjct: 428 RKFMAEEHGVA-LDLMRSIKDTLDPKGILNPGKV 460 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 541 Number of extensions: 36 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 467 Length adjustment: 33 Effective length of query: 433 Effective length of database: 434 Effective search space: 187922 Effective search space used: 187922 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory