Align Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 (characterized)
to candidate WP_076582810.1 BB347_RS14610 D-2-hydroxyacid dehydrogenase
Query= SwissProt::Q9UBQ7 (328 letters) >NCBI__GCF_001971705.1:WP_076582810.1 Length = 317 Score = 125 bits (314), Expect = 1e-33 Identities = 79/225 (35%), Positives = 112/225 (49%), Gaps = 9/225 (4%) Query: 71 AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAI 130 A NL++ + S G+ HL L+ ++RGI V V AE + +L RRL E I Sbjct: 63 AAENLQLFACSSAGVGHLDLETFRERGIAVTNASGVHGPNIAEHVIGWILMITRRLDEGI 122 Query: 131 EEVKNGGWTSWKPLWLCGYGLTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPE 190 + W ++ + S V ++GLG IGQAI RL+ FGV+ G + PE Sbjct: 123 RRQERREWRHFQAM----SDFHDSRVCVVGLGAIGQAILERLEGFGVET---VGVRYSPE 175 Query: 191 EAAEFQAE--FVSTPELAAQSDFIVVACSLTPATEGLCNKDFFQKMKETAVFINISRGDV 248 + F + D++V+AC LT T GL + + AV +N+ RG + Sbjct: 176 KGGPTDEVYGFEEIEQALVDVDYLVLACPLTDETRGLIGAAELETLPPNAVLVNVGRGPL 235 Query: 249 VNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPH 293 V+ D+L AL + + AA LDVT PEPLP +HPL L N I PH Sbjct: 236 VDTDELLSALRNEGLHAAALDVTDPEPLPEDHPLWGLGNVYITPH 280 Lambda K H 0.320 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 317 Length adjustment: 28 Effective length of query: 300 Effective length of database: 289 Effective search space: 86700 Effective search space used: 86700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory