Align arginine decarboxylase (EC 4.1.1.19) (characterized)
to candidate WP_076579764.1 BB347_RS16365 pyruvoyl-dependent arginine decarboxylase
Query= BRENDA::D4GTI7 (157 letters) >NCBI__GCF_001971705.1:WP_076579764.1 Length = 159 Score = 164 bits (414), Expect = 8e-46 Identities = 87/160 (54%), Positives = 111/160 (69%), Gaps = 4/160 (2%) Query: 1 MNTIRVVRGVGTAPTEMASYDAALAAANIHNYNLVAVSSVVPADATVEAVDVAPDLGPAG 60 M+TIR+V G +APT M+SYDAALA A + NYNLV+VSSV+PAD VEAV APDLGPAG Sbjct: 1 MSTIRIVWGAASAPTAMSSYDAALADAGVENYNLVSVSSVIPADTHVEAVGTAPDLGPAG 60 Query: 61 NRLTVVQARETTATPGETVVAGLGWATG--SGPGLFYEASG-TDEDSVRAAVIDGLEAGR 117 RLTVV+AR T PG A L W+ +GPGLFYE SG TD + V V++GL AG+ Sbjct: 61 ERLTVVEARATVTGPGR-ASAALAWSQSVENGPGLFYETSGETDSEDVERRVLEGLAAGQ 119 Query: 118 NLREWSFDDEEVALTTGTHEGEGYTTAVTVAAYGQSESVF 157 LR+W F D +VA + + +TTA+ +A YG+SE ++ Sbjct: 120 ELRDWEFADAQVATESIQAKSGEHTTALVLAVYGESEPIW 159 Lambda K H 0.311 0.127 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 108 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 157 Length of database: 159 Length adjustment: 17 Effective length of query: 140 Effective length of database: 142 Effective search space: 19880 Effective search space used: 19880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory