Align Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (characterized)
to candidate WP_076581564.1 BB347_RS11510 enoyl-CoA hydratase/isomerase family protein
Query= reanno::psRCH2:GFF2389 (257 letters) >NCBI__GCF_001971705.1:WP_076581564.1 Length = 261 Score = 164 bits (414), Expect = 2e-45 Identities = 107/266 (40%), Positives = 150/266 (56%), Gaps = 18/266 (6%) Query: 2 TFETLLVDIQER--VALITLNRPQALNALNGQLISELNQALGQLEA--DPQIGC--IVLT 55 +F+T V+ E V +TLNRP ALNAL+GQL ++ ++L LE D +I +V++ Sbjct: 4 SFDTTTVEFDEDTGVGRVTLNRPDALNALSGQLREDIVESLRLLEEQNDDEIALRVVVVS 63 Query: 56 GSAKAFAAGADIKEMAELT---YPQIYLDDFFADADRIATRRKPLIAAVAGYALGGGCEL 112 G+A F AGADI E + + P+ F D P+IA + GY LGGG E Sbjct: 64 GAAGNFCAGADITEFEDASPGGSPERTHYQFIMDFP------VPVIAKIEGYCLGGGLET 117 Query: 113 ALLCDMIFAADNARFGQPEVNLGVLPGIGGTQRLTRAVGKAKAMDMCLTGRQMDAAEAER 172 A+ CD FA ++AR G PEV+LG++PG GG Q ++ G A A ++ +TG + A A+ Sbjct: 118 AMACDFRFADEDARLGLPEVDLGIIPGAGGVQYISELAGPAAAKEIAMTGDHISATRADE 177 Query: 173 AGLVARVFPAESLLEETLKAARVIAEKSLPATMMIKESVNRAFETTLAEGIRFERRVFHA 232 G+V RV + L E T K A IA K A IK S + +T+L EGI ++ +VF Sbjct: 178 LGIVNRV--PDDLDEATQKFAEKIASKPPLAIQTIKNSARISTQTSLKEGIDYDNKVFEP 235 Query: 233 VFATADQKEGMAAFSE-KRKPEFTNR 257 + AT D KEG AF+E +PEF R Sbjct: 236 LLATEDHKEGARAFAEDDYEPEFKGR 261 Lambda K H 0.321 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 261 Length adjustment: 24 Effective length of query: 233 Effective length of database: 237 Effective search space: 55221 Effective search space used: 55221 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory