Align arginase (EC 3.5.3.1) (characterized)
to candidate WP_076579068.1 BB347_RS01540 agmatinase
Query= metacyc::MONOMER-14987 (338 letters) >NCBI__GCF_001971705.1:WP_076579068.1 Length = 302 Score = 114 bits (286), Expect = 2e-30 Identities = 88/273 (32%), Positives = 143/273 (52%), Gaps = 30/273 (10%) Query: 63 LLGVPLGHNSSFLQGPAFAPPRIREAM--WCGSTNSTTEEGKELDDPRILTDVGDVPVQE 120 ++G PL +++F G F P RIR + T + +L +TD GDV + Sbjct: 41 VVGAPLDVSTTFQPGTRFGPRRIRTFAEPFDDYDRRTDQHFSQLG----VTDHGDVRAWD 96 Query: 121 LRDAGVDDDRLMSIISESVKLVMEENPLRPLVLGGDHSISYPVVRAVSEKLGGPIDILHL 180 D + + + +++ V+ ++ + PL+LGG+H++S VRAVS ++ ++ L Sbjct: 97 ------DVEAYLEYLEGTLRDVVWDDAV-PLMLGGEHTVSLAGVRAVSPEV-----VVCL 144 Query: 181 DAHPDIYHAFEGNKYSHASSFARIMEGGYARRLLQVGIRSINKE--GREQGKRFGVEQYE 238 DAH D+Y A++GN++SHA+ RI+E ++ +G+R+ ++E GR + V Sbjct: 145 DAHLDLYDAYDGNEHSHAAVMRRILEVESVEEVILLGVRTGSEEEWGRAAAEDVTVVPPV 204 Query: 239 MRTFSQDRQFLENLKLGEGVKGVYISVDVDCMDPAFAPGVSHIEPGGLSFRDVLNILHNL 298 + LEN + VY+SVD+D DPA+APG EP GL R++ +++ L Sbjct: 205 DVADWEPGAELEN-------RDVYLSVDIDAADPAYAPGTGTTEPFGLEPREMRDVVRAL 257 Query: 299 QADVVGADVVEFNPQRDTVDGMTAMVAAKLVRE 331 G DVVE N D DG A +A KL+RE Sbjct: 258 APHAGGFDVVEVN---DRDDGQAASLAGKLLRE 287 Lambda K H 0.318 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 302 Length adjustment: 28 Effective length of query: 310 Effective length of database: 274 Effective search space: 84940 Effective search space used: 84940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory