Align Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized)
to candidate WP_076583323.1 BB347_RS14205 phosphonate ABC transporter ATP-binding protein
Query= TCDB::P0AAG3 (241 letters) >NCBI__GCF_001971705.1:WP_076583323.1 Length = 280 Score = 151 bits (381), Expect = 2e-41 Identities = 95/241 (39%), Positives = 142/241 (58%), Gaps = 11/241 (4%) Query: 1 MITLKNVSKWY-GHFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQQGEIT 59 M+T +N+SK Y G + L S +V EVV + GPSG+GKSTLI+ +N L GEI Sbjct: 1 MLTAQNISKTYPGGEEALRGVSFDVTGDEVVAIIGPSGAGKSTLIECINRLTEPTDGEIR 60 Query: 60 VDGIVVND-KKTDLAKLRSRVGMVFQHFELFPHLSIIENLTLAQVKVLK-----RDKAPA 113 +D + V L + R + M+FQ + L L+++EN+ ++ L R K PA Sbjct: 61 LDDVTVTALSDRQLRRTRRDIAMIFQEYNLVERLTVMENVLSGRLGYLSTWNAFRRKFPA 120 Query: 114 R--EKALKLLERVGLSAHANKFPAQLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEM 171 E A + LERVGL H +LSGGQ+QRV IARA+ P ML DEPTS+LDPE Sbjct: 121 EDIEFARETLERVGLGGHERDRADELSGGQRQRVGIARAVVQRPKIMLADEPTSSLDPET 180 Query: 172 INEVLDVMVEL-ANEGMTMMVVTHEMGFARKVANRVIFMDEGKIVEDSPKDAFFDDPKSD 230 + V++++ E+ A+E + +++ HE+ A + A+R+I + +G++V D P +A D+ D Sbjct: 181 SHAVMELLTEIAADERIPVLINIHEVELAVEYADRIIGLADGELVFDGPPEA-LDETAKD 239 Query: 231 R 231 R Sbjct: 240 R 240 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 280 Length adjustment: 24 Effective length of query: 217 Effective length of database: 256 Effective search space: 55552 Effective search space used: 55552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory