Align Methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_076578132.1 BB347_RS04120 enoyl-CoA hydratase
Query= reanno::Pedo557:CA265_RS09125 (258 letters) >NCBI__GCF_001971705.1:WP_076578132.1 Length = 266 Score = 107 bits (268), Expect = 2e-28 Identities = 74/248 (29%), Positives = 124/248 (50%), Gaps = 14/248 (5%) Query: 14 ATITINRPEKKNALNPQLIAELTAAFIKASEDDLVKVVILNANGDAFSAGADLAYLQQLQ 73 ATIT+N+P+++NA + ++ AAF + D + V+L G AFSAG D+ + + Sbjct: 17 ATITLNQPDRRNAFSSEIHDGFVAAFEEIEGSD-ARCVVLQGAGGAFSAGGDVKRMVE-- 73 Query: 74 YNTFEENVADSNHLKKL-------FTTIYYLPKVVIAQVEGHAIAGGCGLATICDIVFAT 126 T EE++ + L T + P IA ++G A+ G LA CD+ A+ Sbjct: 74 --TLEEDIPADERARSLEQRVGEMMTALVNCPIPTIAAIDGPAVGAGANLAIGCDVQLAS 131 Query: 127 PESNFGYTEVKIGF-VPAIVSCFLKEKVSESIAKEILLTGKIFSAEEALKYNLINFVTNS 185 S FG+ ++G V A S L V E++AKE++LTG IF + A + L+N V Sbjct: 132 DRSVFGFVFRQVGLSVDAGTSYLLPRIVGENVAKELVLTGDIFGTDRAEELGLVNHVYAE 191 Query: 186 SDIHQIVREFALSLCSGSSGNSLMITKQLITQTTNPLLEKCLETAVQINARVRESEDFKK 245 + + V EF + SG +L +L+ + + LE+ L V +++D + Sbjct: 192 DEFDENVDEFVEQIVSGPP-VALRHANRLVGEGLDKSLEQALTDEAVAQGIVFDTDDHAE 250 Query: 246 GISSFLNK 253 G+++FL + Sbjct: 251 GVNAFLEE 258 Lambda K H 0.318 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 266 Length adjustment: 25 Effective length of query: 233 Effective length of database: 241 Effective search space: 56153 Effective search space used: 56153 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory