Align 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; CS; EC 2.3.3.5; EC 2.3.3.16 (characterized)
to candidate WP_076581092.1 BB347_RS10075 citrate synthase
Query= SwissProt::H8F0D7 (393 letters) >NCBI__GCF_001971705.1:WP_076581092.1 Length = 382 Score = 271 bits (692), Expect = 3e-77 Identities = 155/372 (41%), Positives = 209/372 (56%), Gaps = 12/372 (3%) Query: 27 DIKKGLAGVVVDTTAISKVVPQTNSLTYRGYPVQDLAARCSFEQVAFLLWRGELPTDAEL 86 D+KKGL GV+V + +S + L YRGY +++LA S+E+V +LLW GELP EL Sbjct: 4 DLKKGLEGVLVAESGLSSIDGDAGRLIYRGYSIEELARGASYEEVLYLLWHGELPGADEL 63 Query: 87 ALFSQRERASRRVDRSMLSLLAKLPD-NCHPMDVVRTAISYLGAEDPDED----DAAANR 141 F+ R V +L + +L + PM +RTA+S L A +P+ D D A Sbjct: 64 ESFTAAINEERDVSEDVLETMERLATADEQPMAALRTAVSMLSASEPETDADPEDLEATL 123 Query: 142 AKAMRMMAVLPTIVAIDMRRRRGLPPIAPHSGLGYAQNFLHMCFGEVPETAVVSAFEQSM 201 K R+ A +PT +A R R P+ PH LG A NFL+M GE P F+Q++ Sbjct: 124 RKGRRITAKIPTALAAFERYRLDEEPVDPHPELGLAANFLYMLTGEEPSDIHAETFDQAL 183 Query: 202 ILYAEHGFNASTFAARVVTSTQSDIYSAVTGAIGALKGRLHGGANEAVMHDMIEIGD-PA 260 IL+A+HG NASTF + V+ ST +DIYSAVTG + AL G LHGGAN+ VM + EI + Sbjct: 184 ILHADHGLNASTFTSMVIGSTMADIYSAVTGGVSALSGPLHGGANQDVMEVLFEIDESDL 243 Query: 261 NAREWLRAKLARKEKIMGFGHRVYRHGDSRVPTMKRALERVGTVRDGQRWLD----IYQV 316 + REW+ +I GFGHRVY D R ++ + + D +W D I Q Sbjct: 244 DHREWVEQANEAGRRIPGFGHRVYNVKDPRAEILQERSKELANEGD-SKWYDYTTTIEQY 302 Query: 317 LAAEMASA-TGILPNLDFPTGPAYYLMGFDIASFTPIFVMSRITGWTAHIMEQATANALI 375 L+ E A GI PN+DF +G YY +G I +TPIF MSR+ GW H++E N LI Sbjct: 303 LSEEQGLAEKGIAPNVDFYSGSVYYQLGIPIDMYTPIFAMSRVGGWVGHVLEYQEDNRLI 362 Query: 376 RPLSAYCGHEQR 387 RPLS Y G E + Sbjct: 363 RPLSRYTGPEDQ 374 Lambda K H 0.321 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 382 Length adjustment: 30 Effective length of query: 363 Effective length of database: 352 Effective search space: 127776 Effective search space used: 127776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory