Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_077276850.1 BW732_RS02750 D-2-hydroxyacid dehydrogenase
Query= BRENDA::C0LJH4 (332 letters) >NCBI__GCF_001998885.1:WP_077276850.1 Length = 327 Score = 293 bits (749), Expect = 5e-84 Identities = 144/322 (44%), Positives = 209/322 (64%), Gaps = 2/322 (0%) Query: 9 RDDERPFFDTWMKENPDVEVKLVPELLTEDNVDLAKGFDGADVYQQKDYTAEVLNKLADE 68 R+DER F + W K++ +V +++ ++L++D L G+DG + Q AE+ KL+ + Sbjct: 5 REDERRFAEKWAKDH-NVTIEVSTDILSDDTYHLLNGYDGLSLQQTMGIPAEMYEKLSQD 63 Query: 69 GVKNISLRNVGVDNLDVPTVKARGLNISNVPAYSPNAIAELSVTQLMQLLRQTPLFNKKL 128 G + I+ R+ GVD D+ K G++I+NVPAYSPNAIAE +V + LR K++ Sbjct: 64 GFRQIAQRSAGVDMYDLKEAKKHGISITNVPAYSPNAIAEFTVASALNCLRHMQAIQKRV 123 Query: 129 AKQDFRWAPDI-AKELNTMTVGVIGTGRIGRAAIDIFKGFGAKVIGYDVYRNAELEKEGM 187 +F W I A+E+ ++T+GV+GTGRIG+ +F FGAKVIGYDVY+N E Sbjct: 124 KNHNFSWDKSILAREVRSLTIGVMGTGRIGQITAQLFAAFGAKVIGYDVYQNPNAENYLT 183 Query: 188 YVDTLDELYAQADVITLHVPALKDNYHMLNADAFSKMKDGAYILNFARGTLIDSEDLIKA 247 Y+D+ DE AQ+D++T+H+P DNYH N + F+KMK GA +LN ARG +ID++DLI A Sbjct: 184 YIDSFDEFLAQSDLLTIHMPLTDDNYHQFNTETFNKMKPGAILLNPARGAIIDTKDLIAA 243 Query: 248 LDSGKVAGAALDTYEYETKIFNKDLEGQTIDDKVFMNLFNRDNVLITPHTAFYTETAVHN 307 LDSG+++ ALDTYE E KD G+T++D + L NR++VL TPH AFYTETAV N Sbjct: 244 LDSGQISCCALDTYENEMPYVTKDWSGKTLNDPILEELINREDVLYTPHIAFYTETAVEN 303 Query: 308 MVHVSMNSNKQFIETGKADTQV 329 +V +++ + G ADT V Sbjct: 304 LVFGGLDACLSILTNGTADTIV 325 Lambda K H 0.317 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 327 Length adjustment: 28 Effective length of query: 304 Effective length of database: 299 Effective search space: 90896 Effective search space used: 90896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory