Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_077276850.1 BW732_RS02750 D-2-hydroxyacid dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_001998885.1:WP_077276850.1 Length = 327 Score = 135 bits (339), Expect = 2e-36 Identities = 87/247 (35%), Positives = 124/247 (50%), Gaps = 27/247 (10%) Query: 71 IAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIVEADAFVRSGE 130 IAQ + G D D++EA K GI +TN P +A A+ A L R + V++ Sbjct: 68 IAQRSAGVDMYDLKEAKKHGISITNVPAYSPNAIAEFTVASALNCLRHMQAIQKRVKNHN 127 Query: 131 --WKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYSRTRKPEAE 188 W KS L ++ T+G++G GRIGQ A+ FG K+I Y + P AE Sbjct: 128 FSWDKS--------ILAREVRSLTIGVMGTGRIGQITAQLFAAFGAKVIGYDVYQNPNAE 179 Query: 189 EEIGAEYVD-FETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINTSRGAVVDT 247 + Y+D F+ L +SD +++H+PLT + YH + MKP AIL+N +RGA++DT Sbjct: 180 NYL--TYIDSFDEFLAQSDLLTIHMPLTDDNYHQFNTETFNKMKPGAILLNPARGAIIDT 237 Query: 248 NALIKALKEGWIAGAGLDVFEEE-PYYN-------------EELFKLKNVVLAPHIGSAT 293 LI AL G I+ LD +E E PY EEL ++V+ PHI T Sbjct: 238 KDLIAALDSGQISCCALDTYENEMPYVTKDWSGKTLNDPILEELINREDVLYTPHIAFYT 297 Query: 294 HEAREGM 300 A E + Sbjct: 298 ETAVENL 304 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 327 Length adjustment: 28 Effective length of query: 303 Effective length of database: 299 Effective search space: 90597 Effective search space used: 90597 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory