Align 2-deoxy-D-ribonate dehydrogenase (characterized)
to candidate WP_077275113.1 BW732_RS01410 acetoin reductase
Query= metacyc::MONOMER-20835 (262 letters) >NCBI__GCF_001998885.1:WP_077275113.1 Length = 258 Score = 108 bits (270), Expect = 1e-28 Identities = 77/253 (30%), Positives = 121/253 (47%), Gaps = 8/253 (3%) Query: 16 LISGGAAGIGEVLAAAYLEAGAQVHVCDVSESALAVFRDKYPG----TVATRADVSDAAQ 71 +++G A G+G+ +A G + + D++ LA +++ T+ DVS Sbjct: 6 VVTGSAGGLGKGIAERLARDGFSIVLHDINSQKLAETVEEFKTNGFETIGVTGDVSKKVD 65 Query: 72 IEAVFKVQREHLGGLDVLVNNAGIAGPTGGIDAISDAEWQATININLTAQ-YRFAHHAVP 130 E++ E G LDVLVNNAG+ T +D I++ E Q NIN+ + A Sbjct: 66 QESLITQAVETFGRLDVLVNNAGVDAVTPLLD-ITEKELQTIFNINVNGTVFGTQAAATQ 124 Query: 131 MLKESSHGHLLHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESDIRVNALLPGI 190 +K+ G +++ S+AG Y Y A+K A+ + A EL + I VNA PGI Sbjct: 125 FIKQGEKGKIINACSIAGHESYDMLGTYCASKHAVRSFTHTAAKELAKHQITVNAYCPGI 184 Query: 191 VEGPRMDGVIRARAE--QVGVPEAEMRQEYLNKISLKRMVTAEDVAAMALFLCSPAARNV 248 + D + A + Q + E +++ I+L+R EDVA + FL S A + Sbjct: 185 AKTEMWDRIDAAMVQHSQGRLKPGESFEQFTAGIALQRYQVPEDVANLVSFLASDEADYI 244 Query: 249 TGQAISVDGNVEY 261 TGQAI DG + Y Sbjct: 245 TGQAILTDGGLVY 257 Lambda K H 0.318 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 258 Length adjustment: 24 Effective length of query: 238 Effective length of database: 234 Effective search space: 55692 Effective search space used: 55692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory