Align 1-phosphofructokinase; EC 2.7.1.56; Fructose 1-phosphate kinase (uncharacterized)
to candidate WP_077275495.1 BW732_RS03535 hexose kinase
Query= curated2:O31714 (303 letters) >NCBI__GCF_001998885.1:WP_077275495.1 Length = 312 Score = 167 bits (423), Expect = 3e-46 Identities = 101/308 (32%), Positives = 178/308 (57%), Gaps = 14/308 (4%) Query: 1 MIYTVTLNPSVDYIVHVEDFTVGGLNRSSYDTKYPGGKGINVSRLLKRHHVASKALGFVG 60 MI TVT+NPSVD + + +NR + +K GGKG+NV+R++ + + + G +G Sbjct: 1 MIVTVTMNPSVDIAYTLPHLNLDQVNRCNQVSKTAGGKGLNVTRVIHQMNQDVVSTGLLG 60 Query: 61 GFTGEYIKTFLREENLETAFSEVKGDTR--INVKLKTGDETEINGQGPTISDEDFKAFLE 118 G G++I+ L ++ ++ FS++ G TR + + G +TEI GPTI+ + K F E Sbjct: 61 GALGDFIRESLTKDGIKHNFSDIDGQTRNCLAILHDNGAQTEILEAGPTITAAELKRF-E 119 Query: 119 QFQS--LQEGDIVVLAGSIPSSLPHDTYEKIAEACKQQNARVVLDISGEALLKA--TEMK 174 Q + L E D++ L+GS+P +P + Y ++ E + + +VVLD SG++L++ + +K Sbjct: 120 QVMANLLPESDVMTLSGSLPKGIPTNYYVRLLELMSKDSIKVVLDTSGQSLIEVLQSSVK 179 Query: 175 PFLMKPNHHELGEMFGTAITSVEEAVPYGKKL-VEQGAEHVIVSMAGDGALLFTNEAVYF 233 P+ +KPN EL ++ +T+ E A+ + +G ++VS+ DGA + + Y Sbjct: 180 PYAIKPNLDELSDLTNQILTADETALKQALTADIFEGIPLIVVSLGSDGAFVKYTDRFYR 239 Query: 234 ANVPKGKLVNSVGAGDSVVAGFLAGISKQLPLEE----AFRLGVTSGS--ATAFSEELGT 287 +PK +VN VG+GDS VAG G+ K+ +E+ A LG+++ + AT + ++ Sbjct: 240 VTIPKITVVNPVGSGDSTVAGIAIGLQKKESIEKVIKRAMALGMSNATHQATGYIDQDSY 299 Query: 288 EEFVQQLL 295 +EF +Q+L Sbjct: 300 QEFEKQIL 307 Lambda K H 0.315 0.134 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 235 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 312 Length adjustment: 27 Effective length of query: 276 Effective length of database: 285 Effective search space: 78660 Effective search space used: 78660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory