Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate WP_077274914.1 BW732_RS00300 D-threitol dehydrogenase
Query= uniprot:B2T9V3 (247 letters) >NCBI__GCF_001998885.1:WP_077274914.1 Length = 254 Score = 124 bits (311), Expect = 2e-33 Identities = 83/252 (32%), Positives = 123/252 (48%), Gaps = 21/252 (8%) Query: 5 LAGKTALITAAGQGIGLATAELFAREGARVIATDIR------IDGLAGKPVEARKLDVRD 58 L K A+IT GIG A EL+ ++GA++ DI ++ G +DV Sbjct: 12 LENKVAIITGGLSGIGSAIGELYVKKGAKLAIFDINPDTPELVEEQFGTKAIGFAVDVTS 71 Query: 59 DA----AIKALAAEIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAMYRMIRAFL 114 A+K +D+L N AG + SE +WD F++NVK + + +A Sbjct: 72 KEQVMNAVKETMNHFKKIDILVNSAGVCFLDDAENLSETEWDLTFNINVKGSFLVAQAVG 131 Query: 115 PAMLDKGGGSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITRGVRCNAICP 174 M+ GGG IINM+S A+ V + N AY+ASK A++ +TK +A ++ + N + P Sbjct: 132 NEMIQSGGGKIINMASQAALV-ALDNHVAYAASKGAILSMTKVLAYEWAQYSINVNCLSP 190 Query: 175 GTVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALYLGSDESSFT 234 IV + A V + P+GR G PEE+AA AL+L SD S+ Sbjct: 191 ----------TIVLTELGKKAWAGQVGEDMKQQIPIGRFGYPEEVAASALFLASDASNLM 240 Query: 235 TGHAHVIDGGWS 246 TG VIDGG++ Sbjct: 241 TGENMVIDGGYT 252 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 254 Length adjustment: 24 Effective length of query: 223 Effective length of database: 230 Effective search space: 51290 Effective search space used: 51290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory