Align Short-chain dehydrogenase/reductase SDR (characterized, see rationale)
to candidate WP_077275131.1 BW732_RS01515 glucose 1-dehydrogenase
Query= uniprot:B2T9V3 (247 letters) >NCBI__GCF_001998885.1:WP_077275131.1 Length = 261 Score = 113 bits (283), Expect = 3e-30 Identities = 83/259 (32%), Positives = 126/259 (48%), Gaps = 25/259 (9%) Query: 1 MTQRLAGKTALITAAGQGIGLATAELFAREGARVIATDIRIDGLAGKPVEARKLDVRDDA 60 M Q L GK A+IT +GIG A +E +E +V+ + A + VEA K D Sbjct: 1 MYQDLNGKVAVITGGSKGIGTAISERLGKEKMKVVVNYHSDEAGANQAVEAVKAAGGDGI 60 Query: 61 AIKA--------------LAAEIGAVDVLFNCAGFVHAGNILECSEEDWDFAFDLNVKAM 106 A++A +E G +D+ N AG + + EDW+ ++N+ + Sbjct: 61 AVQANVGSEEGVQKLVDVALSEYGTLDLWINNAGMENQCETHKLPLEDWERVINVNLTGV 120 Query: 107 YRMIRAFLPAMLDKGG-GSIINMSSAASSVKGVPNRFAYSASKAAVIGLTKSVAADFITR 165 + +A L ++ G+IIN+SS + P YSASK V LT++VA ++ R Sbjct: 121 FLGTKAALSYFVENNKKGNIINISSVHEQIPW-PTFAHYSASKGGVKLLTETVAMEYANR 179 Query: 166 GVRCNAICPGTVASPSLEQRIVAQAQAQGATLDAVQAAFVARQPMGRIGKPEEIAALALY 225 +R N I PG + +P ++ Q Q T + + PM RIG PEE+AA A + Sbjct: 180 NIRVNNIGPGAIKTPINAEKFADPEQLQ-TTKETI--------PMQRIGNPEEVAAAAAW 230 Query: 226 LGSDESSFTTGHAHVIDGG 244 L SDE+S+ TG +DGG Sbjct: 231 LASDEASYVTGITLFVDGG 249 Lambda K H 0.320 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 261 Length adjustment: 24 Effective length of query: 223 Effective length of database: 237 Effective search space: 52851 Effective search space used: 52851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory