Align ABC transporter for D-Galactose and D-Glucose, permease component 2 (characterized)
to candidate WP_077275421.1 BW732_RS03120 carbohydrate ABC transporter permease
Query= reanno::pseudo13_GW456_L13:PfGW456L13_1896 (281 letters) >NCBI__GCF_001998885.1:WP_077275421.1 Length = 283 Score = 127 bits (318), Expect = 4e-34 Identities = 80/265 (30%), Positives = 131/265 (49%), Gaps = 12/265 (4%) Query: 22 LLAAAVYLIPLVVMLLTSFKSPEDIRTGNLLSWPTVIDGIGWIKAWDVVG--GYFWNSVK 79 LLA PL + ++ + K P + N+L WPT + AW++ F N++ Sbjct: 25 LLAILTIFGPLYMTVMIAVKDPSQM--SNVLKWPTTFHWENFQHAWELTDYPQKFKNTLV 82 Query: 80 ITVPAVLISTFIGAMNGYVLSMWRFRGSQLFFGLLLF----GCFLPFQTVLLPASFTLGK 135 ITV ++ + F ++ Y ++ R R + FF L + F+PF ++LP Sbjct: 83 ITVVNLIFTVFTNSLAAYAIT--RKRSTSKFFNALYYYFISAMFIPFNVIMLPLVKQASF 140 Query: 136 FGLANTTTGLVLVHVVYGLAFTTLFFRNYYVSIPDALVKAARLDGAGFFTIFLKILLPMS 195 F L N G++ +++++GL T + + IP AL +AA +DGA F I+ PM Sbjct: 141 FNLDNLA-GIIFIYIIFGLPMNTFLYTGFIKKIPVALDEAAEIDGATPLQTFRYIIFPML 199 Query: 196 IPIVMVCLIWQFTQIWNDFLFGVVFASGDAQPITVALNNLVNTSTGAKEYNVDMAAAMIA 255 P+ I F WNDFL ++ S Q T+ L+ + + +YN+ A+ ++ Sbjct: 200 KPVHATVAILSFMWTWNDFLMPLILLSKPEQQ-TLQLSQYIFQGQFSTQYNLAFASYLLV 258 Query: 256 GLPTLLVYIFAGKYFLRGLTSGAVK 280 LP LL+YIF K+ + G+T GAVK Sbjct: 259 ILPVLLIYIFFQKWIIAGVTDGAVK 283 Lambda K H 0.329 0.143 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 283 Length adjustment: 26 Effective length of query: 255 Effective length of database: 257 Effective search space: 65535 Effective search space used: 65535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory