Align D-tagatose-1,6-bisphosphate aldolase subunit GatY; TBPA; TagBP aldolase; D-tagatose-bisphosphate aldolase class II; Tagatose-bisphosphate aldolase; EC 4.1.2.40 (characterized)
to candidate WP_077275372.1 BW732_RS02830 class II fructose-bisphosphate aldolase
Query= SwissProt::Q8VS16 (284 letters) >NCBI__GCF_001998885.1:WP_077275372.1 Length = 278 Score = 164 bits (416), Expect = 2e-45 Identities = 98/275 (35%), Positives = 147/275 (53%), Gaps = 9/275 (3%) Query: 1 MFIISSKNMLLKAQRLGYAVPAFNIHNLETMQVVVETAAELRSPLILAGTPGTYSYAGTG 60 M +++SK + KA+ YA+PA N +L++ + V A PLILA Sbjct: 1 MVLVNSKELFKKAREEQYAIPACNFFDLDSARSYVAVAERENKPLILALAEAHLDMISLE 60 Query: 61 NVVAIARDLAKIWDLPLAVHLDHHEDLADITRKVQAGIRSVMIDGSHSPFEENVALVKSV 120 I + LA+ +P+ +HLDH + L+ I R + SVMID S S F ENVAL K V Sbjct: 61 EGALIGKYLAEKATVPVVLHLDHGQTLSVIERAIDLDFTSVMIDKSESTFAENVALTKKV 120 Query: 121 VELSHRYDASVEAELGRLGGVEDDLGVDAKDALYTNPEQGREFVARTGIDSLAVVIGTAH 180 V ++ + +VEAE+G +G + + KD++YT FV T +DSLA+ IGTAH Sbjct: 121 VAMAKGKNVAVEAEIGHVGSGVNYENHEVKDSIYTEVSDAVTFVEETQVDSLAISIGTAH 180 Query: 181 GLYAAEPKLGFAALPPISERVDVPLVLHGASKLPDSDIRRAISLGVCKVNVATELKIAFS 240 G Y EPK+ F L I+++VD+PLVLHG S D +++R G+ K+N+ F+ Sbjct: 181 GAYKGEPKINFDRLIDIAKQVDIPLVLHGGSSSGDENLKRCAVTGIEKINI-------FT 233 Query: 241 DALKHYFEENPDANEPRHYMKPAKAAMKDVVRKVI 275 D + FE + +P Y++ KA + K + Sbjct: 234 DFINSAFEA-ITSEQPTDYLQ-VKAVANQAIEKTL 266 Lambda K H 0.319 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 284 Length of database: 278 Length adjustment: 26 Effective length of query: 258 Effective length of database: 252 Effective search space: 65016 Effective search space used: 65016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory