Align 6-phosphofructokinase isozyme 1; EC 2.7.1.11 (characterized)
to candidate WP_077274884.1 BW732_RS00135 6-phosphofructokinase
Query= CharProtDB::CH_024070 (320 letters) >NCBI__GCF_001998885.1:WP_077274884.1 Length = 320 Score = 322 bits (824), Expect = 1e-92 Identities = 160/304 (52%), Positives = 215/304 (70%) Query: 2 IKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSDM 61 +K+I +LTSGGDAPGMNAAIR V R A+ EG+EV GI GY GL + +LD V D+ Sbjct: 1 MKRIAILTSGGDAPGMNAAIRAVTRKAIFEGMEVYGINYGYAGLVAGDIKKLDVPDVGDI 60 Query: 62 INRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPCI 121 I +GGT L SAR+PEF E + IE LKK GI+ LVVIGGDGSY GA+ LT GFP + Sbjct: 61 IQKGGTCLYSARYPEFASEEGQLKGIEQLKKFGIEGLVVIGGDGSYHGALALTRRGFPAV 120 Query: 122 GLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLAA 181 G+PGTIDNDI GTD+TIGF TA++TV++AIDR+RDT++SH R ++EVMGR GD+ L A Sbjct: 121 GIPGTIDNDIPGTDFTIGFDTAINTVLDAIDRIRDTATSHVRTFIIEVMGRDAGDIALWA 180 Query: 182 AIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETGR 241 +AGG + +++PE +F E + +++ G +GKKH ++ + E + E A + + Sbjct: 181 GVAGGADDIIIPEHDFDMESVAKKVRIGRDRGKKHCLIILAEGVMPGHEFAEKLSEYGDF 240 Query: 242 ETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDAI 301 +R +VLGHI RGGSP DR+LAS+ GAYA+DLL AG GG CVG+ + Q+V DI++ + Sbjct: 241 HSRVSVLGHIVRGGSPTARDRVLASKFGAYAVDLLKAGRGGLCVGMFDNQVVATDIVETL 300 Query: 302 ENMK 305 E+ K Sbjct: 301 ESRK 304 Lambda K H 0.322 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 23 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 320 Length adjustment: 28 Effective length of query: 292 Effective length of database: 292 Effective search space: 85264 Effective search space used: 85264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory