Align tagatose-bisphosphate aldolase (EC 4.1.2.40) (characterized)
to candidate WP_077275496.1 BW732_RS03540 tagatose-bisphosphate aldolase
Query= BRENDA::Q5HE13 (326 letters) >NCBI__GCF_001998885.1:WP_077275496.1 Length = 330 Score = 392 bits (1007), Expect = e-114 Identities = 195/324 (60%), Positives = 251/324 (77%), Gaps = 2/324 (0%) Query: 4 SNQKIASIEQLSNNEGIISALAFDQRGALKRMMAKHQTEEPTVAQIEQLKVLVAEELTQY 63 S K+ + QLS +G+I+ALA DQRGALK+M+A + I K LV+EELT Y Sbjct: 5 STNKLTYMNQLSTEDGVIAALAIDQRGALKKMLAADGYKGDVEQAIIDFKKLVSEELTPY 64 Query: 64 ASSILLDPEYGLPASDARNKDCGLLLAYEKTGYDVNAKGRLPDCLVEWSAKRLKEQGANA 123 +SSILLDPEYGLPA+ +++ GLLLAYE+TGYD GR PD + ++SA RLKE GA+A Sbjct: 65 SSSILLDPEYGLPAASVKSETAGLLLAYEQTGYDATEPGRFPDLIHDYSALRLKEAGADA 124 Query: 124 VKFLLYYDVDDAEEINIQKKAYIERIGSECVAEDIPFFLEVLTYDDNIPDNGSVEFAKVK 183 VKFLLYYD+D++EEIN +K+A++ERIGSECVA+DIPF+LE+++YD I D S E+AKVK Sbjct: 125 VKFLLYYDIDESEEINQRKQAFVERIGSECVAQDIPFYLELVSYDATIDDPKSKEYAKVK 184 Query: 184 PRKVNEAMKLFSEPRFNVDVLKVEVPVNMKYVEGFAEG--EVVYTKEEAAQHFKDQDAAT 241 P KVN+ M FS+ R++VDVLK+EVPVNM YVEGFA+ +VVYT EEA Q+F++Q AAT Sbjct: 185 PHKVNDMMVEFSKDRYHVDVLKMEVPVNMNYVEGFAKDAEDVVYTAEEAKQYFREQSAAT 244 Query: 242 HLPYIYLSAGVSAELFQETLKFAHEAGAKFNGVLCGRATWSGAVQVYIEQGEDAAREWLR 301 HLP+I+LSAGVSA+LFQ+TL FA EAG++FNGVLCGRATW V V+++ GE A R WL+ Sbjct: 245 HLPFIFLSAGVSAKLFQDTLYFAKEAGSEFNGVLCGRATWKDGVSVFVKDGEQATRIWLQ 304 Query: 302 TTGFKNIDDLNKVLKDTATSWKQR 325 T G NI++LN L TATSW ++ Sbjct: 305 TEGRNNIEELNTALAATATSWHKK 328 Lambda K H 0.315 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 330 Length adjustment: 28 Effective length of query: 298 Effective length of database: 302 Effective search space: 89996 Effective search space used: 89996 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory