Align triose-phosphate isomerase (EC 5.3.1.1) (characterized)
to candidate WP_077275371.1 BW732_RS02825 triose-phosphate isomerase
Query= BRENDA::B6YUE5 (226 letters) >NCBI__GCF_001998885.1:WP_077275371.1 Length = 230 Score = 139 bits (349), Expect = 6e-38 Identities = 78/220 (35%), Positives = 128/220 (58%), Gaps = 6/220 (2%) Query: 4 LKEPIIAINFKTYIEATGERALEIAKAAEKVWKETGITIVVAPQLADLYRIAQEV-EIPV 62 L+ P +N K Y+ G++ L++AK A + + I+ Q DL I Q+ ++ V Sbjct: 5 LRAPFFVVNPKAYLY--GDKLLDLAKVANDLATRYDLDILFTAQHIDLAMIKQQCPKLFV 62 Query: 63 FAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMTMV 122 AQH+D G GH+LPEA+ G T LNH+E+ M L++L A+ A ++T+V Sbjct: 63 TAQHLDGFSLGRGMGHILPEALASVGVQATFLNHAEHAMTLSELVKAMEFARNYNILTIV 122 Query: 123 CSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVITDTVELVKRVNPEVKVLTG 182 C+N+ A+A+L PD + EP ELIGTG + + DT +L+K ++P+ +VL Sbjct: 123 CANSYEEVKAIASLKPDVMVCEPNELIGTG---QTSDDNYMIDTQKLIKEISPQTQVLQA 179 Query: 183 AGISTGEDVKKALELGSVGVLLASGVTKAKDPEKAIRDLV 222 AGIST DV++A +LG+ G SG+ A++P++ + +++ Sbjct: 180 AGISTVADVERAFKLGAEGTGGTSGIVCAENPQQILTEMI 219 Lambda K H 0.314 0.132 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 127 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 226 Length of database: 230 Length adjustment: 23 Effective length of query: 203 Effective length of database: 207 Effective search space: 42021 Effective search space used: 42021 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory