Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate WP_077276299.1 BW732_RS08225 SDR family oxidoreductase
Query= metacyc::MONOMER-11802 (255 letters) >NCBI__GCF_001998885.1:WP_077276299.1 Length = 259 Score = 98.6 bits (244), Expect = 1e-25 Identities = 79/264 (29%), Positives = 125/264 (47%), Gaps = 25/264 (9%) Query: 1 MHIANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKAREL---GDNARFAV 57 M I NK +++GA SG+G ATA E GA V L+D+N Q ++ +E+ A + V Sbjct: 2 MDIRNKRVVITGAGSGIGRATALKFAELGAVVGLIDINEQGLDDIVKEIYRHNGEAYYEV 61 Query: 58 ADISDEQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAKVINVNLIG 117 D+ DE+ + + G L GLV AGI G + + + + I+ NL Sbjct: 62 VDVMDEERLMEGIAQLANQLGGLDGLVCNAGINGTWAPIETL---KIEDWHRTIDTNLTS 118 Query: 118 SFNLLRLAAAAMAEGAADESGERGVIINTASIAA--YDGQIGQAAYAASKGAIASLTLPA 175 +F L+ A M + + G I+ T+SI G +AY+ SK SL A Sbjct: 119 TFVSLKAAIPLMKD-------DGGSIVITSSINGNRIYNNFGASAYSTSKAGQVSLMKMA 171 Query: 176 ARELARFGIRVMTIAPGIFETP-----MMAGMSDEVRASL---AAGVPFPPRLGRPQEYA 227 A ELAR IRV + PG ETP ++ ++EV+ + P G+P++ A Sbjct: 172 ALELARCNIRVNAVCPGAIETPINSKTIIEKETEEVQIKVEFPEGDRPLKADTGQPEQVA 231 Query: 228 ALARHII--ENSMLNGEVIRLDGA 249 + +I ++ ++G + +DGA Sbjct: 232 NVIAFLISSQSGNVSGTEVYVDGA 255 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 106 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 259 Length adjustment: 24 Effective length of query: 231 Effective length of database: 235 Effective search space: 54285 Effective search space used: 54285 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory