Align 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase; DKGP aldolase; EC 4.1.2.29 (characterized)
to candidate WP_077276429.1 BW732_RS08955 fructose-bisphosphate aldolase
Query= SwissProt::P42420 (290 letters) >NCBI__GCF_001998885.1:WP_077276429.1 Length = 288 Score = 260 bits (665), Expect = 2e-74 Identities = 139/290 (47%), Positives = 188/290 (64%), Gaps = 8/290 (2%) Query: 1 MAFVSMKELLEDAKREQYAIGQFNINGLQWTKAILQAAQKEQSPVIAAASDRLVDYLGGF 60 MA VS E+L+ A+ +YA+G FN N L+WTKAILQ AQ+ +PV+ S Y+GG+ Sbjct: 1 MALVSATEMLKKAREGKYAVGAFNTNNLEWTKAILQGAQESNAPVMIQTSMGAAKYMGGY 60 Query: 61 KTIAAMVGALIEDMAITVPVVLHLDHGSSAERCRQAIDAGFSSVMIDGSHQPIDENIAMT 120 + +V LI+ M ITVPV LHLDHG + + I G++SVM DGSH P DEN+A Sbjct: 61 QVCYDLVKDLIDSMGITVPVALHLDHGEYKDAI-ECIKVGYTSVMFDGSHLPFDENLAKA 119 Query: 121 KEVTDYAAKHGVSVEAEVGTVGGMEDGLVGGVRYADITECERIVKETNIDALAAALGSVH 180 KEV +A +GVSVE EVG++GG EDG++G AD EC +++ +T ID LAA +G++H Sbjct: 120 KEVVSFAHINGVSVECEVGSIGGEEDGIIGAGELADPNEC-KLMSDTGIDFLAAGIGNIH 178 Query: 181 GKYQGE-PNLGFKEMEAISRMTD-IPLVLHGASGIPQDQIKKAITLGHAKININTECMVA 238 G Y L F+ +EAI+ +TD PLVLHG SGIP DQI+ AI G +KIN+NTEC Sbjct: 179 GAYPTNWAGLSFETLEAIANVTDGKPLVLHGGSGIPLDQIQTAIAHGVSKINVNTECQEV 238 Query: 239 WTDETRRMFQENSDL----YEPRGYLTPGIEAVEETVRSKMREFGSAGKA 284 + TR+ +EN DL ++PR L PG +AV + V+ ++ FGS KA Sbjct: 239 FAAATRKYIEENKDLQGKGFDPRKLLAPGTQAVVDLVKERIEWFGSKDKA 288 Lambda K H 0.316 0.132 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 18 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 288 Length adjustment: 26 Effective length of query: 264 Effective length of database: 262 Effective search space: 69168 Effective search space used: 69168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory