Align 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale)
to candidate WP_077276087.1 BW732_RS07065 acetyl-CoA C-acetyltransferase
Query= uniprot:A0A2Z5MFE9 (400 letters) >NCBI__GCF_001998885.1:WP_077276087.1 Length = 395 Score = 271 bits (692), Expect = 3e-77 Identities = 155/399 (38%), Positives = 244/399 (61%), Gaps = 9/399 (2%) Query: 1 MNDAYICDAIRTPIGRYGGALKDVRADDLGAVPIKALIQRNPGVDWRAVDDVIYGCANQA 60 M + I A+RTP G+ GG +DV A DLGA +KA +Q++ GV A+D V+ G QA Sbjct: 1 MTRSVILSAVRTPFGKLGGVFRDVPAVDLGATAMKAAVQKS-GVAIDAIDYVVMGQVLQA 59 Query: 61 GEDNRNVARMSALLAGLPADAPGATINRLCGSGMDAVGTAARAIKAGEAQLMIAGGVESM 120 G + +R +++ AGL TIN++C S + AV A + I++G+ +++AGG+ESM Sbjct: 60 GV-GQIPSRQASIKAGLDWSIGSETINKVCASSLRAVTLADQMIRSGDLDVVLAGGMESM 118 Query: 121 TRAPFVMGKAASAFTRQAEIHDTTIGWRFVNPLMKRQYGVDSMPETAENVAEQFGISRAD 180 + APF A+ + ++ + V+ + Y M AE++GISR Sbjct: 119 SDAPF----ASKDLRWGQRMFNSQMVDLMVHDGLWDAYYNQHMAVNGGYGAEKYGISREA 174 Query: 181 QDAFALASQQKAARAQRDGTLAQEIVGVEIAQKKGDAIRVTLDEHPRETS-LESLARLKG 239 QD +AL SQQ A++A G L +EI+ VE+ Q++G+ I +T DE PR T+ L L RL+G Sbjct: 175 QDEWALRSQQLASQAMESGVLEEEIIPVEVPQRRGEPIAITKDEAPRPTTTLADLQRLQG 234 Query: 240 VVRPDGTVTAGNASGVNDGACALLIASQQAAEQYGLRRRARVVGMATAGVEPRIMGIGPA 299 + + T+TAGNA G NDGA AL+IAS++ A++ G++ A ++G A +GVE R++ P Sbjct: 235 LFKEGNTITAGNAPGTNDGASALMIASEEKAKELGIQPLATILGHAESGVETRLIASAPG 294 Query: 300 PATQKLLRQLGMTLDQLDVIELNEAFASQGLAVLRMLGLRDDDPRVNPNGGAIALGHPLG 359 A +KLL++ +T+ +D+ E+NEAFA+ L +ML + + ++N NGGAIA GHP+G Sbjct: 295 HAIEKLLKEHDLTIADIDLFEINEAFAAVTLVTQKMLDIPSE--KINVNGGAIAFGHPIG 352 Query: 360 ASGARLVTTALHQLERSNGRFALCTMCIGVGQGIALVIE 398 ASG R++ T +H++ R + + +C G QG A++I+ Sbjct: 353 ASGGRIIGTLVHEMRRRKAVYGIAAICSGAAQGDAVLIK 391 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 388 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 395 Length adjustment: 31 Effective length of query: 369 Effective length of database: 364 Effective search space: 134316 Effective search space used: 134316 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory