Align L-rhamnose-1-dehydrogenase; EC 1.1.1.173 (characterized)
to candidate WP_077275131.1 BW732_RS01515 glucose 1-dehydrogenase
Query= SwissProt::A3LZU7 (258 letters) >NCBI__GCF_001998885.1:WP_077275131.1 Length = 261 Score = 154 bits (389), Expect = 2e-42 Identities = 88/250 (35%), Positives = 141/250 (56%), Gaps = 5/250 (2%) Query: 5 LNGKVVAITGGVTGIGRAIAIEMARNGAKVVVNHLPSEEQAQLAKE-LKEEISDGENNVL 63 LNGKV ITGG GIG AI+ + + KVVVN+ E A A E +K DG + Sbjct: 5 LNGKVAVITGGSKGIGTAISERLGKEKMKVVVNYHSDEAGANQAVEAVKAAGGDG----I 60 Query: 64 TIPGDISLPETGRRIVELAVEKFGEINVFVSNAGVCGFREFLEITPETLFQTVNINLNGA 123 + ++ E +++V++A+ ++G ++++++NAG+ E ++ E + +N+NL G Sbjct: 61 AVQANVGSEEGVQKLVDVALSEYGTLDLWINNAGMENQCETHKLPLEDWERVINVNLTGV 120 Query: 124 FFAIQAAAQQMVKQGKGGSIIGISSISALVGGAHQTHYTPTKAGILSLMQSTACALGKYG 183 F +AA V+ K G+II ISS+ + HY+ +K G+ L ++ A Sbjct: 121 FLGTKAALSYFVENNKKGNIINISSVHEQIPWPTFAHYSASKGGVKLLTETVAMEYANRN 180 Query: 184 IRCNAILPGTISTALNEEDLKDPEKRKYMEGRIPLGRVGDPKDIAGPAIFLASDMSNYVN 243 IR N I PG I T +N E DPE+ + + IP+ R+G+P+++A A +LASD ++YV Sbjct: 181 IRVNNIGPGAIKTPINAEKFADPEQLQTTKETIPMQRIGNPEEVAAAAAWLASDEASYVT 240 Query: 244 GAQLLVDGGL 253 G L VDGG+ Sbjct: 241 GITLFVDGGM 250 Lambda K H 0.317 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 156 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 261 Length adjustment: 24 Effective length of query: 234 Effective length of database: 237 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory