Align Sorbitol dehydrogenase (EC 1.1.1.14) (characterized)
to candidate WP_077275711.1 BW732_RS04765 (S)-acetoin forming diacetyl reductase
Query= reanno::Phaeo:GFF1301 (257 letters) >NCBI__GCF_001998885.1:WP_077275711.1 Length = 260 Score = 164 bits (414), Expect = 2e-45 Identities = 90/248 (36%), Positives = 141/248 (56%), Gaps = 3/248 (1%) Query: 9 ALITGAARGIGAAFAEAYANEGARVVIADIDTARAEATAAQIG---AAAIAVELDVTDQA 65 A +TG +GIG A A +G ++ +AD + A A +I A+A+++DV+D+ Sbjct: 9 AFVTGGGQGIGKAICLRLAQDGFKIAVADYNFDTATEVANEINNKEGQAVAIKVDVSDRE 68 Query: 66 SIDRALSRTVECFGGLDILINNAAVFTAAPLVEVTREAYQRTFDINVSGTLFMMQAAAQQ 125 ++ A+ E GG D+++NNA + P+ E+T + Y+R FDINV GT++ MQAA + Sbjct: 69 AVFAAVEEAKEKLGGFDVIVNNAGLGPQTPIEEITYDTYRRVFDINVGGTIWGMQAAIKA 128 Query: 126 MITQGTGGKIINMASQAGRRGEPLVSVYCATKAAVISLTQSAGLNLISHGINVNAIAPGV 185 + G GGKIIN +SQAG+ G P ++VY ++K A+ LTQ+A +L + GI VNA PG+ Sbjct: 129 FKSLGHGGKIINASSQAGQVGNPGLAVYGSSKFAIRGLTQTAAKDLANLGITVNAYCPGI 188 Query: 186 VDGEHWDGVDAFFAKYEGKAPGQKKAEVAQSVPYGRMGTAADLTGMAVFLASEDADYVVA 245 V G+ AK GK + +Q++ R+ D+ +LA D+DY+ Sbjct: 189 VKTPMMMGIAEQTAKEAGKPFEWGLEQFSQNITLKRLSEPEDVAACVSYLAGPDSDYMTG 248 Query: 246 QTYNVDGG 253 Q +DGG Sbjct: 249 QALIIDGG 256 Lambda K H 0.317 0.130 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 260 Length adjustment: 24 Effective length of query: 233 Effective length of database: 236 Effective search space: 54988 Effective search space used: 54988 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory