Align D-xylose 1-dehydrogenase (EC 1.1.1.175) (characterized)
to candidate WP_077276299.1 BW732_RS08225 SDR family oxidoreductase
Query= BRENDA::B8H1Z0 (248 letters) >NCBI__GCF_001998885.1:WP_077276299.1 Length = 259 Score = 85.9 bits (211), Expect = 7e-22 Identities = 80/258 (31%), Positives = 116/258 (44%), Gaps = 30/258 (11%) Query: 9 LKGKRVVITGGGSGIGAGLTAGFARQGAEVIFLDIADEDSRALEAELAGSPIPPVYKRCD 68 ++ KRVVITG GSGIG FA GA V +DI ++ + E+ Y+ D Sbjct: 4 IRNKRVVITGAGSGIGRATALKFAELGAVVGLIDINEQGLDDIVKEIYRHNGEAYYEVVD 63 Query: 69 LMN----LEAIKAVFAEIGDVDVLVNNAG-NDDRHKLADVTGAYWDERINVNLRHMLFCT 123 +M+ +E I + ++G +D LV NAG N + + W I+ NL Sbjct: 64 VMDEERLMEGIAQLANQLGGLDGLVCNAGINGTWAPIETLKIEDWHRTIDTNLTSTFVSL 123 Query: 124 QAVAPGMKKRGGGAV----INFGSISWHLGLEDLVLYETAKAGIEGMTRALARELGPDDI 179 +A P MK GG V IN I + G Y T+KAG + + A EL +I Sbjct: 124 KAAIPLMKDDGGSIVITSSINGNRIYNNFGAS---AYSTSKAGQVSLMKMAALELARCNI 180 Query: 180 RVTCVVPGNVKT-------------KRQEKWYTPEGEAQIVAAQCLKGRIVPENVAALVL 226 RV V PG ++T + Q K PEG+ + A G+ PE VA ++ Sbjct: 181 RVNAVCPGAIETPINSKTIIEKETEEVQIKVEFPEGDRPLKAD---TGQ--PEQVANVIA 235 Query: 227 FLASDDASLCTGHEYWID 244 FL S + +G E ++D Sbjct: 236 FLISSQSGNVSGTEVYVD 253 Lambda K H 0.319 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 133 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 259 Length adjustment: 24 Effective length of query: 224 Effective length of database: 235 Effective search space: 52640 Effective search space used: 52640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory