Align 3-oxoadipate CoA-transferase (subunit 1/2) (EC 2.8.3.6) (characterized)
to candidate WP_078210856.1 BXU11_RS02160 CoA transferase subunit B
Query= BRENDA::P0A102 (213 letters) >NCBI__GCF_002017945.1:WP_078210856.1 Length = 218 Score = 211 bits (536), Expect = 1e-59 Identities = 102/207 (49%), Positives = 144/207 (69%), Gaps = 2/207 (0%) Query: 7 LSRTEMAQRVAADIQEGAYVNLGIGAPTLVANYLG-DKEVFLHSENGLLGMGPSPAPGEE 65 L++ ++A+R+A ++Q+G +VNLGIG PTLVANY+ D V SENG+LGMGP P GEE Sbjct: 2 LTKEDIAKRIAKEVQDGYFVNLGIGIPTLVANYVREDISVEFQSENGVLGMGPFPFEGEE 61 Query: 66 DDDLINAGKQHVTLLTGGAFFHHADSFSMMRGGHLDIAVLGAFQVSVKGDLANWHTGAEG 125 D DLINAGKQ +T L G +FF A SF M+RG H+D+ +LGA +V+ GD+ANW + Sbjct: 62 DADLINAGKQTITTLPGASFFDSATSFGMIRGQHVDLTILGAMEVAENGDIANWKIPGK- 120 Query: 126 SIPAVGGAMDLATGARQVFVMMDHLTKTGESKLVPECTYPLTGIACVSRIYTDLAVLEVT 185 + +GGAMDL A + V M H+ K GESK++ +CT PLTG+ CV ++ T+LAV+E+T Sbjct: 121 MVKGMGGAMDLVASAENIIVAMMHVNKAGESKILKKCTLPLTGVGCVKKVVTELAVMEIT 180 Query: 186 PEGLKVVEICADIDFDELQKLSGVPLI 212 P+G K++E + +E+ K + LI Sbjct: 181 PKGFKLLERAPGVSIEEIIKATEASLI 207 Lambda K H 0.318 0.137 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 218 Length adjustment: 22 Effective length of query: 191 Effective length of database: 196 Effective search space: 37436 Effective search space used: 37436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory