Align Arginine transport ATP-binding protein ArtM (characterized)
to candidate WP_078212710.1 BXU11_RS12070 phosphate ABC transporter ATP-binding protein
Query= SwissProt::P54537 (240 letters) >NCBI__GCF_002017945.1:WP_078212710.1 Length = 252 Score = 159 bits (402), Expect = 5e-44 Identities = 93/244 (38%), Positives = 141/244 (57%), Gaps = 11/244 (4%) Query: 2 IKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEK-----PNGG 56 I V LS +G+ + L ++S I +V A+IGPSG GKSTFLRC+N + G Sbjct: 6 IDVTDLSLFYGEKKALSSVSMQIQANKVTALIGPSGCGKSTFLRCINRMNDLIPGVKISG 65 Query: 57 TITIKDTEITKPKTNTLKVRENIGMVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEK 116 + ++ +I + + + +R+ IGMVFQ + FP K++ EN+ Y P ++K E Sbjct: 66 RMLVEGIDIYDKEVDVVNIRKKIGMVFQKSNPFP-KSIFENVAYGPRINGIKNKTQLDEI 124 Query: 117 AEDLLRKVGLFE----KRNDYPNRLSGGQKQRVAIARALAMNPDIMLFDEPTSALDPEMV 172 E LR+ ++E + +D LSGGQ+QR+ IAR LA+NPDI+L DEP SALDP Sbjct: 125 VEVSLRQAAIWEELKDRLDDSAMGLSGGQQQRLCIARTLAVNPDIILMDEPASALDPLST 184 Query: 173 KEVLQVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRA 232 ++ +++ EL E T+VIVTH M A +D F G ++E G K+ F P+ K+ Sbjct: 185 SKIEELVHELKEQ-YTIVIVTHNMQQAARTSDHTAFFYMGELIEMGKTKDIFTKPEKKQT 243 Query: 233 QDFL 236 +D++ Sbjct: 244 EDYI 247 Lambda K H 0.317 0.134 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 8 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 252 Length adjustment: 24 Effective length of query: 216 Effective length of database: 228 Effective search space: 49248 Effective search space used: 49248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory